Recombinant Full Length Arabidopsis Thaliana Cbs Domain-Containing Protein Cbsx6(Cbsx6) Protein, His-Tagged
Cat.No. : | RFL16747AF |
Product Overview : | Recombinant Full Length Arabidopsis thaliana CBS domain-containing protein CBSX6(CBSX6) Protein (Q8GZA4) (1-425aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Arabidopsis thaliana |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-425) |
Form : | Lyophilized powder |
AA Sequence : | MASVFLYHVVGDLTVGKPEMVEFYETETVESAIRAIGESTECGIPVWRKRTTPSLPGFVE NSEMRQQRFVGILNSLDIVAFLAKTECLQEEKAMKIPVSEVVSPDNTLLKQVDPGTRLID ALEMMKQGVRRLLVPKSVVWRGMSKRFSILYNGKWLKNSENSSSSSGLSADSTNRPTTSM TSSRDKFCCLSREDVIRFLIGVLGALAPLPLTSISTLGIINQNYNFIEASLPAIEATRRP LCDPSAIAVLEQTENEQQFKIIGEISASKLWKCDYLAAAWALANLYAGQFVMGVEDNMSS RSFSDFLQTSFPGGEQNGTATNAKKFSSRSIGFNPTSPTRLSIGRSMYRGRSAPLTCKTS SSLAAVMAQMLSHRATHVWVTEADSDDVLVGVVGYGEILTAVTKQPSAFVPSNRSYEGFG NENQS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | CBSX6 |
Synonyms | CBSX6; At1g65320; T8F5.10; CBS domain-containing protein CBSX6 |
UniProt ID | Q8GZA4 |
◆ Recombinant Proteins | ||
RFL29463MF | Recombinant Full Length Mycoplasma Pulmonis Prolipoprotein Diacylglyceryl Transferase(Lgt) Protein, His-Tagged | +Inquiry |
DCK-11853H | Recombinant Human DCK, GST-tagged | +Inquiry |
TNKS2-4693R | Recombinant Rhesus Macaque TNKS2 Protein, His (Fc)-Avi-tagged | +Inquiry |
GFM2-13231H | Recombinant Human GFM2, GST-tagged | +Inquiry |
CRCBA-2071B | Recombinant Bacillus subtilis CRCBA protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
Streptavidin-24 | Streptavidin | +Inquiry |
BPI-72H | Native Human Bacterial/Permeability-Increasing Protein | +Inquiry |
CA6-804H | Native Human CA6 | +Inquiry |
Fgg -69R | Native Rat Fibrinogen | +Inquiry |
S100B-1116H | Native Human S100B Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
DHX30-6932HCL | Recombinant Human DHX30 293 Cell Lysate | +Inquiry |
CDH8-991RCL | Recombinant Rat CDH8 cell lysate | +Inquiry |
ITGA3-5134HCL | Recombinant Human ITGA3 293 Cell Lysate | +Inquiry |
TTC1-689HCL | Recombinant Human TTC1 293 Cell Lysate | +Inquiry |
C10orf35-8366HCL | Recombinant Human C10orf35 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All CBSX6 Products
Required fields are marked with *
My Review for All CBSX6 Products
Required fields are marked with *
0
Inquiry Basket