Recombinant Full Length Arabidopsis Thaliana Casp-Like Protein At5G40300(At5G40300) Protein, His-Tagged
Cat.No. : | RFL20059AF |
Product Overview : | Recombinant Full Length Arabidopsis thaliana CASP-like protein At5g40300(At5g40300) Protein (Q9FNE8) (1-270aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Arabidopsis thaliana |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-270) |
Form : | Lyophilized powder |
AA Sequence : | MEELEKTQKFQKKKKQQQEKQDQSSPINFEMSSRSSLHSLPQTTIESPPDSPTLSSIPDS HGSSPHTIIPTPSVAKTETPFRVTNGEEEKKVSESRRQLRPSFSSSSSTPRESKWASLIR KALLGFRVIAFVSCLVSFSVMVSDRDKGWAHDSFYNYKEFRFCLAANVIGFVYSGFMICD LVYLLSTSIRRSRHNLRHFLEFGLDQMLAYLLASASTSASIRVDDWQSNWGADKFPDLAR ASVALSYVSFVAFAFCSLASGYALCALRSI |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | At5g40300 |
Synonyms | At5g40300; MPO12.1; CASP-like protein 4A1; AtCASPL4A1 |
UniProt ID | Q9FNE8 |
◆ Native Proteins | ||
IgA-204M | Native Monkey Immunoglobulin A | +Inquiry |
Lectin-1851U | Active Native Ulex Europaeus Agglutinin I Protein, DyLight 594 labeled | +Inquiry |
C3a-08H | Native Human Complement C3 alpha protein | +Inquiry |
GC-524H | Native Human GC protein | +Inquiry |
TNNI3-223H | Native Human Troponin I Type 3 (Cardiac) | +Inquiry |
◆ Cell & Tissue Lysates | ||
NOTUM-3754HCL | Recombinant Human NOTUM 293 Cell Lysate | +Inquiry |
STK38-1400HCL | Recombinant Human STK38 293 Cell Lysate | +Inquiry |
SPG21-726HCL | Recombinant Human SPG21 cell lysate | +Inquiry |
SNTA1-1608HCL | Recombinant Human SNTA1 293 Cell Lysate | +Inquiry |
ACVRL1-994CCL | Recombinant Canine ACVRL1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All At5g40300 Products
Required fields are marked with *
My Review for All At5g40300 Products
Required fields are marked with *
0
Inquiry Basket