Recombinant Full Length Arabidopsis Thaliana Aluminum-Activated Malate Transporter 8(Almt8) Protein, His-Tagged
Cat.No. : | RFL11024AF |
Product Overview : | Recombinant Full Length Arabidopsis thaliana Aluminum-activated malate transporter 8(ALMT8) Protein (Q9SRM9) (1-488aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Arabidopsis thaliana |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-488) |
Form : | Lyophilized powder |
AA Sequence : | MDLNAQEKKAGFFQRLQDFPSKLKDDVTKRVKNVQKFAKDDPRRIIHSMKVGVALTLVSL LYYVRPLYISFGVTGMWAILTVVVVFEFTVGGTLSKGLNRGFATLIAGALGVGAVHLARF FGHQGEPIVLGILVFSLGAAATFSRFFPRIKQRYDYGALIFILTFSFVAISGYRTDEILI MAYQRLSTILIGGTICILVSIFICPVWAGEDLHKMIANNINKLAKYLEGFEGEYFQPEKI SKETSSCVREYKSILTSKSTEDSLANLARWEPGHGRFRLRHPWKKYLKIAGLVRQCAVHL EILNGYVLSNDKAPQEFESKIQEPITTMSREVGEALKAIAKSIKTMRNDSACVNAHIDNS KKAIKNLKIALKSSYPETYKDLLEIIPGVTMASILIEVVNCVEKIYEAVEEFSGLAHFKE TLDSKLSAEIGQHQLLHRGCVKPVLDGDNEKEDNSSCHVLITVHDEGYLPTATAKNVLGA EKTRVDIV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ALMT8 |
Synonyms | ALMT8; At3g11680; T19F11.8; Aluminum-activated malate transporter 8; AtALMT8 |
UniProt ID | Q9SRM9 |
◆ Recombinant Proteins | ||
KRTAP21-3-1566H | Recombinant Human KRTAP21-3 | +Inquiry |
YUEG-2802B | Recombinant Bacillus subtilis YUEG protein, His-tagged | +Inquiry |
Aaas-3246M | Recombinant Mouse Aaas, His-tagged | +Inquiry |
ARXA-8960Z | Recombinant Zebrafish ARXA | +Inquiry |
PRPF31-3442R | Recombinant Rhesus Macaque PRPF31 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
Lectin-1788G | Active Native Griffonia Simplicifolia Lectin II Protein, Biotinylated | +Inquiry |
FG-116H | Native Human Fibrinogen | +Inquiry |
Immunoglobulin G4-84H | Native Human Immunoglobulin G4 | +Inquiry |
Lectin-1818P | Active Native Peanut Lectin Protein | +Inquiry |
CST3-8100H | Native Human Cystatin C (Cystatin 3) | +Inquiry |
◆ Cell & Tissue Lysates | ||
TRMU-751HCL | Recombinant Human TRMU 293 Cell Lysate | +Inquiry |
PTAFR-2731HCL | Recombinant Human PTAFR 293 Cell Lysate | +Inquiry |
KLK10-4905HCL | Recombinant Human KLK10 293 Cell Lysate | +Inquiry |
Colon-86R | Rabbit Colon Lysate | +Inquiry |
MMP9-1940RCL | Recombinant Rat MMP9 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ALMT8 Products
Required fields are marked with *
My Review for All ALMT8 Products
Required fields are marked with *
0
Inquiry Basket