Recombinant Full Length Arabidopsis Thaliana Aluminum-Activated Malate Transporter 1(Almt1) Protein, His-Tagged
Cat.No. : | RFL11789AF |
Product Overview : | Recombinant Full Length Arabidopsis thaliana Aluminum-activated malate transporter 1(ALMT1) Protein (Q9SJE9) (1-493aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Arabidopsis thaliana |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-493) |
Form : | Lyophilized powder |
AA Sequence : | MEKVREIVREGIRVGNEDPRRIIHAFKVGLALVLVSSFYYYQPFGPFTDYFGINAMWAVM TVVVVFEFSVGATLGKGLNRGVATLVAGGLGIGAHQLARLSGATVEPILLVMLVFVQAAL STFVRFFPWVKTKFDYGILIFILTFALISLSGFRDEEIMDLAESRLSTVVIGGVSCILIS IFVCPVWAGQDLHSLLASNFDTLSHFLQDFGDEYFEAREKGDYKVVEKRKKNLERYKSVL DSKSDEEALANYAEWEPPHGQFRFRHPWKQYVAVGALLRQCAYRIDALNSYINSDFQIPV DIKKKLETPLRRMSSESGNSMKEMSISLKQMIKSSSSDIHVSNSQAACKSLSTLLKSGIL NDVEPLQMISLMTTVSMLIDIVNLTEKISESVHELASAARFKNKMRPTVLYEKSDSGSIG RAMPIDSHEDHHVVTVLHDVDNDRSNNVDDSRGGSSQDSCHHVAIKIVDDNSNHEKHEDG EIHVHTLSNGHLQ |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ALMT1 |
Synonyms | ALMT1; At1g08430; T27G7.11; Aluminum-activated malate transporter 1; AtALMT1 |
UniProt ID | Q9SJE9 |
◆ Recombinant Proteins | ||
MMP15-4578H | Recombinant Human MMP15 Protein (His410-Leu553), N-His tagged | +Inquiry |
Spike-705V | Recombinant COVID-19 Spike NTD protein(BA.2.75/Omicron), His-tagged | +Inquiry |
NHP2L1-28304TH | Recombinant Human NHP2L1, His-tagged | +Inquiry |
UGT2A1-6433R | Recombinant Rat UGT2A1 Protein | +Inquiry |
YUTG-4011B | Recombinant Bacillus subtilis YUTG protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
GGT1-8130H | Native Human Liver Gamma-Glutamyltransferase | +Inquiry |
ALOD-36 | Active Native Alcohol oxidase | +Inquiry |
TIMP1-91B | Active Native Bovine Thrombin | +Inquiry |
TTR-155B | Native Bovine Prealbumin protein | +Inquiry |
HBA1-8158H | Native Hemoglobin A1C (HbA1c) | +Inquiry |
◆ Cell & Tissue Lysates | ||
SRSF4-588HCL | Recombinant Human SRSF4 lysate | +Inquiry |
NAPRT1-1165HCL | Recombinant Human NAPRT1 cell lysate | +Inquiry |
GLTSCR2-5892HCL | Recombinant Human GLTSCR2 293 Cell Lysate | +Inquiry |
PRKAR1A-1009HCL | Recombinant Human PRKAR1A cell lysate | +Inquiry |
HOP62-048WCY | Human Lung Adenocarcinoma HOP62 Whole Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ALMT1 Products
Required fields are marked with *
My Review for All ALMT1 Products
Required fields are marked with *
0
Inquiry Basket