Recombinant Full Length Arabidopsis Thaliana Abc Transporter G Family Member 6(Abcg6) Protein, His-Tagged
Cat.No. : | RFL15594AF |
Product Overview : | Recombinant Full Length Arabidopsis thaliana ABC transporter G family member 6(ABCG6) Protein (Q9FNB5) (1-727aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Arabidopsis thaliana |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-727) |
Form : | Lyophilized powder |
AA Sequence : | MSRVVAADDNMALPFFSPEFGNVSGASSSPTTFAQLLQNVDDSTRRSHHQHHVDVDLASP DQSVPFVLSFTDLTYSVKVRRKFTWRRSVSSDPGAPSEGIFSSKTKTLLNGITGEARDGE ILAVLGASGSGKSTLIDALANRIAKGSLKGNVTLNGEVLNSKMQKAISAYVMQDDLLFPM LTVEETLMFAAEFRLPRSLSKSKKSLRVQALIDQLGLRNAANTVIGDEGHRGISGGERRR VSIGIDIIHDPILLFLDEPTSGLDSTSALSVIKVLKRIAQSGSMVIMTLHQPSYRLLRLL DRLLFLSRGQTVFSGSPAMLPRFFAEFGHPIPEHENRTEFALDLIRELEGSAGGTRSLVE FNKGFRQRKAEPRSQTGLSLKEAISASISKGKLVSGATTTTHSSGSSPVSTIPTFANPFW VELAVLAKRSMTNSRRQPELFGIRLGAVLVTGFILATMFWQLDNSPKGVQERLGCFAFAM STTFYTCADALPVFLQERFIFMRETAYNAYRRSSYVLSHSLVALPSLIILSLAFAAITFW GVGLDGGLMGFLFYFLVILASFWAGSSFVTFLSGVVPHVMLGYTIVVAILAYFLLFSGFF INRDRIPGYWIWFHYISLVKYPYEAVLLNEFGDPTKCFVRGVQIFDNTPLVAVPQGMKVR LLATMSKSLGMRITSSTCLTTGYDILQQQGVTDLTKWNCLWVTVAWGFFFRILFYFSLLL GSKNKRR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ABCG6 |
Synonyms | ABCG6; WBC6; At5g13580; MSH12.4; ABC transporter G family member 6; ABC transporter ABCG.6; AtABCG6; White-brown complex homolog protein 6; AtWBC6 |
UniProt ID | Q9FNB5 |
◆ Recombinant Proteins | ||
MENC-1200B | Recombinant Bacillus subtilis MENC protein, His-tagged | +Inquiry |
CPVL-1823H | Recombinant Human CPVL Protein, GST-tagged | +Inquiry |
SCHIP1-3912R | Recombinant Rhesus Macaque SCHIP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Psmg2-1071M | Recombinant Mouse Psmg2 protein, His & T7-tagged | +Inquiry |
SIGLEC15-0674H | Active Recombinant Human SIGLEC15 protein, mFc-tagged | +Inquiry |
◆ Native Proteins | ||
CED026 | Active Bovine Superoxide Dismutase (SOD), High Purity >95% | +Inquiry |
Prothrombin-4S | Native Snake E. Carinatus Viper Venom Prothrombin Activator | +Inquiry |
Lectin-1870W | Active Native Wisteria Floribunda Lectin Protein, Fluorescein labeled | +Inquiry |
CST3-8100H | Native Human Cystatin C (Cystatin 3) | +Inquiry |
TRIM21-212B | Native Cow TRIM21 | +Inquiry |
◆ Cell & Tissue Lysates | ||
OR10A5-3569HCL | Recombinant Human OR10A5 293 Cell Lysate | +Inquiry |
ZIK1-163HCL | Recombinant Human ZIK1 293 Cell Lysate | +Inquiry |
KIAA0141-898HCL | Recombinant Human KIAA0141 cell lysate | +Inquiry |
TRMT12-755HCL | Recombinant Human TRMT12 293 Cell Lysate | +Inquiry |
SULT1A2-1355HCL | Recombinant Human SULT1A2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ABCG6 Products
Required fields are marked with *
My Review for All ABCG6 Products
Required fields are marked with *
0
Inquiry Basket