Recombinant Full Length Arabidopsis Thaliana Abc Transporter G Family Member 5(Abcg5) Protein, His-Tagged
Cat.No. : | RFL9097AF |
Product Overview : | Recombinant Full Length Arabidopsis thaliana ABC transporter G family member 5(ABCG5) Protein (Q9SIT6) (1-649aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Arabidopsis thaliana |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-649) |
Form : | Lyophilized powder |
AA Sequence : | MEKQGCEIEALDIDYNIFVRKINVNPFGIFRRKPRPEADQPVKTEEESLKLEDETGNKVK HVLKGVTCRAKPWEILAIVGPSGAGKSSLLEILAARLIPQTGSVYVNKRPVDRANFKKIS GYVTQKDTLFPLLTVEETLLFSAKLRLKLPADELRSRVKSLVHELGLEAVATARVGDDSV RGISGGERRRVSIGVEVIHDPKVLILDEPTSGLDSTSALLIIDMLKHMAETRGRTIILTI HQPGFRIVKQFNSVLLLANGSTLKQGSVDQLGVYLRSNGLHPPLHENIVEFAIESIESIT KQQRLQESRRAAHVLTPQTTLQEKRSEDSQGESKSGKFTLQQLFQQTRVADVGTMNIATE FTRDFANSRLEETMILTHRFSKNIFRTKELFACRTVQMLGSGIVLGLIFHNLKDDLKGAR ERVGLFAFILTFLLTSTIEALPIFLQEREILMKETSSGSYRVSSYAVANGLVYLPFLLIL AILFSTPVYWLVGLNPSFMAFLHFSLLIWLILYTANSVVVCFSALVPNFIVGNSVISGVM GSFFLFSGYFISNHEIPGYWIFMHYISLFKYPFEGFLINEFSKSNKCLEYGFGKCLVTEE DLLKEERYGEESRWRNVVIMLCFVLLYRFISYVILRCRCSQRSFKTTLA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ABCG5 |
Synonyms | ABCG5; WBC5; At2g13610; T10F5.15; ABC transporter G family member 5; ABC transporter ABCG.5; AtABCG5; White-brown complex homolog protein 5; AtWBC5 |
UniProt ID | Q9SIT6 |
◆ Recombinant Proteins | ||
TAF12-2460H | Recombinant Human TAF12 protein, His-tagged | +Inquiry |
KEAP1B-6291Z | Recombinant Zebrafish KEAP1B | +Inquiry |
MYL5-29364TH | Recombinant Human MYL5, His-tagged | +Inquiry |
GH1-263H | Recombinant Human GH1, StrepII-tagged | +Inquiry |
CYB5R3-2039HFL | Recombinant Full Length Human CYB5R3 Protein, C-Flag-tagged | +Inquiry |
◆ Native Proteins | ||
IgG-332S | Native Swine IgG | +Inquiry |
NPPB-8052R | Native Rat Brain Natriuretic Peptide-32 | +Inquiry |
IgG-343M | Native MONKEY IgG | +Inquiry |
Lectin-1779G | Active Native Griffonia Simplicifolia Lectin I Protein, Biotinylated | +Inquiry |
PRTN3-242H | Native Human Proteinase 3 | +Inquiry |
◆ Cell & Tissue Lysates | ||
ATP5I-8598HCL | Recombinant Human ATP5I 293 Cell Lysate | +Inquiry |
PAIP2-3459HCL | Recombinant Human PAIP2 293 Cell Lysate | +Inquiry |
RUNX3-2106HCL | Recombinant Human RUNX3 293 Cell Lysate | +Inquiry |
SLAMF9-1808HCL | Recombinant Human SLAMF9 293 Cell Lysate | +Inquiry |
TOMM6-698HCL | Recombinant Human TOMM6 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ABCG5 Products
Required fields are marked with *
My Review for All ABCG5 Products
Required fields are marked with *
0
Inquiry Basket