Recombinant Full Length Arabidopsis Thaliana Abc Transporter G Family Member 21(Abcg21) Protein, His-Tagged
Cat.No. : | RFL34687AF |
Product Overview : | Recombinant Full Length Arabidopsis thaliana ABC transporter G family member 21(ABCG21) Protein (Q7XA72) (1-672aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Arabidopsis thaliana |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-672) |
Form : | Lyophilized powder |
AA Sequence : | MMPPNEQESSFPKTPSANRHETSPVQENRFSSPSHVNPCLDDDNDHDGPSHQSRQSSVLR QSLRPIILKFEELTYSIKSQTGKGSYWFGSQEPKPNRLVLKCVSGIVKPGELLAMLGPSG SGKTTLVTALAGRLQGKLSGTVSYNGEPFTSSVKRKTGFVTQDDVLYPHLTVMETLTYTA LLRLPKELTRKEKLEQVEMVVSDLGLTRCCNSVIGGGLIRGISGGERKRVSIGQEMLVNP SLLLLDEPTSGLDSTTAARIVATLRSLARGGRTVVTTIHQPSSRLYRMFDKVLVLSEGCP IYSGDSGRVMEYFGSIGYQPGSSFVNPADFVLDLANGITSDTKQYDQIETNGRLDRLEEQ NSVKQSLISSYKKNLYPPLKEEVSRTFPQDQTNARLRKKAITNRWPTSWWMQFSVLLKRG LKERSHESFSGLRIFMVMSVSLLSGLLWWHSRVAHLQDQVGLLFFFSIFWGFFPLFNAIF TFPQERPMLIKERSSGIYRLSSYYIARTVGDLPMELILPTIFVTITYWMGGLKPSLTTFI MTLMIVLYNVLVAQGVGLALGAILMDAKKAATLSSVLMLVFLLAGGYYIQHIPGFIAWLK YVSFSHYCYKLLVGVQYTWDEVYECGSGLHCSVMDYEGIKNLRIGNMMWDVLALAVMLLL YRVLAYLALRNL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ABCG21 |
Synonyms | ABCG21; WBC21; At3g25620; T5M7.6; ABC transporter G family member 21; ABC transporter ABCG.21; AtABCG21; White-brown complex homolog protein 21; AtWBC21 |
UniProt ID | Q7XA72 |
◆ Recombinant Proteins | ||
UGT1A9-821C | Recombinant Cynomolgus Monkey UGT1A9 Protein, His (Fc)-Avi-tagged | +Inquiry |
METTL21A-9756M | Recombinant Mouse METTL21A Protein | +Inquiry |
PPP1R12C-1178H | Recombinant Human PPP1R12C | +Inquiry |
STIP1-3536H | Recombinant Human STIP1 protein, His-SUMO-tagged | +Inquiry |
RFL36789AF | Recombinant Full Length Aspergillus Niger Protein Get1(Get1) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
DPP4-197H | Native Human Dipeptidyl Peptidase IV | +Inquiry |
Lectin-1769D | Active Native Dolichos Biflorus Agglutinin Protein, Biotinylated | +Inquiry |
LOC100514666-45P | Native Porcine Fibrinogen, FITC Labeled | +Inquiry |
293T-01NE | Native HEK293 Nuclear Extract | +Inquiry |
Lectin-1839S | Active Native Sambucus Nigra Lectin Protein, Cy3 labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
TRIM27-786HCL | Recombinant Human TRIM27 293 Cell Lysate | +Inquiry |
KIR3DX1-981HCL | Recombinant Human KIR3DX1 cell lysate | +Inquiry |
RAB37-2601HCL | Recombinant Human RAB37 293 Cell Lysate | +Inquiry |
GABRG3-6056HCL | Recombinant Human GABRG3 293 Cell Lysate | +Inquiry |
EPCAM-2525HCL | Recombinant Human EPCAM cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ABCG21 Products
Required fields are marked with *
My Review for All ABCG21 Products
Required fields are marked with *
0
Inquiry Basket