Recombinant Full Length Arabidopsis Thaliana Abc Transporter B Family Member 27(Abcb27) Protein, His-Tagged
Cat.No. : | RFL18742AF |
Product Overview : | Recombinant Full Length Arabidopsis thaliana ABC transporter B family member 27(ABCB27) Protein (Q0WML0) (1-644aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Arabidopsis thaliana |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-644) |
Form : | Lyophilized powder |
AA Sequence : | MGNKKLLTGGSSKTHGSGSSYRDPLLQNQEDKPKANGSENGLNDLEHGVVEAANVGFGRV FALAKPDAGKLVIGTIALLIGSTTNLLVPKFGGMIIDIVSRDVKTPEQQTESLIAVRNAV VIILLIVVIGSICTALRAWLFNSASERVVARLRKDLFRHLMHQEIAFYDVTKTGELLSRL SEDTQIIKNAATTNLSEALRNVTTALIGVGFMFTSSWKLTLLALVVVPVISVAVKQFGRY LRELSHTTQAAAAVAASIAEESFGAVRTVRSFAKESYMVSQYSKKVDETLKLGLKQAVLV GLFFGGLNAAFTLSVITVVSYGAYLTIYGSMTVGALTSFILYSLTVGSSVSSLSSLYTTA MKAAGASRRVFQILDRVSSMSSSGDKCPVGNPDGDVELNDVWFAYPSRPSHMILKGISLR LTPGSKVALVGPSGGGKTTIANLIERFYDPLKGKILLNGVSLMEISHQYLHKQISIVSQE PILFNCSVEENIAYGFDGEASFTDIENAAKMANAHEFIEAFPDKYNTVVGERGLRLSGGQ KQRIAIARALLTNPSVLLLDEATSALDAESEYLVQDAMDSLMAGRTVLVIAHRLSTVKTA DCVAVISDGEVAEKGTHDELLSLNGIYTNLVKRQLQSSSSVTTL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ABCB27 |
Synonyms | ABCB27; ALS1; TAP2; At5g39040; MXF12.50; ABC transporter B family member 27; ABC transporter ABCB.27; AtABCB27; Aluminum tolerance-related ATP-binding cassette transporter; Antigen peptide transporter-like 2; Transporter associated with antigen processing |
UniProt ID | Q0WML0 |
◆ Recombinant Proteins | ||
CIDEC-81HF | Recombinant Full Length Human CIDEC Protein | +Inquiry |
PRSS22-0795H | Recombinant Human PRSS22 Protein (Ala33-Ser317), C-His tagged | +Inquiry |
CIRH1A-1376H | Recombinant Human CIRH1A Protein, GST-tagged | +Inquiry |
Arg2-8244R | Recombinant Rat Arg2 protein, His-tagged | +Inquiry |
CRYAB-422C | Recombinant Cynomolgus CRYAB Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
TF-324H | Native Human Transferrin, Texas Red Label | +Inquiry |
ALB-314H | Native Human Albumin Fluorescein | +Inquiry |
Collagen-58M | Native Mouse Collagen Type II | +Inquiry |
Mucin-312 | Native Porcine Mucin Type II protein | +Inquiry |
MARCKS-12B | Native Bovine MARCKS protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
UGT3A2-1882HCL | Recombinant Human UGT3A2 cell lysate | +Inquiry |
F7-001MCL | Recombinant Mouse F7 cell lysate | +Inquiry |
MED28-4384HCL | Recombinant Human MED28 293 Cell Lysate | +Inquiry |
ATCAY-8634HCL | Recombinant Human ATCAY 293 Cell Lysate | +Inquiry |
HSD17B7-819HCL | Recombinant Human HSD17B7 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ABCB27 Products
Required fields are marked with *
My Review for All ABCB27 Products
Required fields are marked with *
0
Inquiry Basket