Recombinant Full Length Human CIDEC Protein

• Cat.No.: CIDEC-81HF
• Product Overview: Recombinant full length Human CIDEC with proprietary tag; Predicted MWt 52.29 kDa.

Specification

• Description: This gene encodes a member of the cell death-inducing DNA fragmentation factor-like effector family. Members of this family play important roles in apoptosis. The encoded protein promotes lipid droplet formation in adipocytes and may mediate adipocyte apoptosis. This gene is regulated by insulin and its expression is positively correlated with insulin sensitivity. Mutations in this gene may contribute to insulin resistant diabetes. A pseudogene of this gene is located on the short arm of chromosome 3. Alternatively spliced transcript variants that encode different isoforms have been observed for this gene.
• Source: In Vitro Cell Free System
• Species: Human
• Form: Liquid
• Molecular Mass: 52.290kDa inclusive of tags
• Protein length: 238 amino acids
• AA Sequence: MEYAMKSLSLLYPKSLSRHVSVRTSVVTQQLLSEPSPKAPRARPCRVSTADRSVRKGIMAYSLEDLLLKVRDTLMLADKPFFLVLEEDGTTVETEEYFQALAGDTVFMVLQKGQKWQPPSEQGTRHPLSLSHKPAKKIDVARVTFDLYKLNPQDFIGRLNVKATFYDTYSLSYDLHCCGAKRIMKEAFRWALFSMQATGHVLLGTSCYLQQLLDATEEGQPPKGKASSLIPTCLKILQ
• Purity: Proprietary Purification
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles.
• Storage Buffer: pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione.

Gene Information

• Gene Name: CIDEC cell death-inducing DFFA-like effector c [ Homo sapiens ]
• Official Symbol: CIDEC
• Synonyms: CIDEC; cell death-inducing DFFA-like effector c; cell death activator CIDE-3; CIDE 3; FLJ20871; Fsp27
• Gene ID: 63924
• mRNA Refseq: NM_001199551
• Protein Refseq: NP_001186480
• MIM: 612120
• UniProt ID: Q96AQ7