Recombinant Full Length Arabidopsis Thaliana Abc Transporter B Family Member 23, Mitochondrial(Abcb23) Protein, His-Tagged
Cat.No. : | RFL36059AF |
Product Overview : | Recombinant Full Length Arabidopsis thaliana ABC transporter B family member 23, mitochondrial(ABCB23) Protein (Q9FUT3) (71-678aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Arabidopsis thaliana |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (71-678) |
Form : | Lyophilized powder |
AA Sequence : | NQDQTKTASSKKILRTISSYLWMKDNPELRFRVIAALACLIGAKFLNVQVPFLFKLSIDL LSSYSSSTITDSNPYLLAAFATPSSVLIGYGIARSGSSAFNELRTAVFSKVSLRTIRSVS RKVLSHLHDLDLRYHLNRETGALNRIIDRGSRAINTILSAMVFNVVPTILEISMVTGILA YNFGPVFALITSLSVGSYIAFTLVVTQYRTKFRKAMNQADNDASTRAIDSLVNYETVKYF NNEDYEARKYDDLLGRYEDAALQTQKSLAFLDFGQSFIFSTALSTSMVLCSQGIMNGEMT VGDLVMVNGLLFQLSLPLYFLGGVYRETVQGLVDMKSLFQLLEERSDIGDKDTETKLPPL VLRGGSISFENVHFSYLPERKILDGISFEVPAGKSVAIVGSSGSGKSTILRMIFRFFDTD SGNVRIDGQDIKEVTLESLRSCIGVVPQDTVLFNDTIFHNIHYGNLSATEEEVYDAARRA VIHDTIMKFPDKYSTAVGERGLMLSGGEKQRVALARAFLKSPAILLCDEATNALDSKTEA EIMKTFRSLASNRTCIFIAHRLTTAMQCDEIIVMEKGKVVEKGTHQVLLEKSGRYAKLWT QQNSTLEV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ABCB23 |
Synonyms | ABCB23; ATM1; STA2; At4g28630; T5F17.80; ABC transporter B family member 23, mitochondrial; ABC transporter ABCB.23; AtABCB23; ABC transporter of the mitochondrion 1; AtATM1; Iron-sulfur clusters transporter ATM1; Protein STARIK 2 |
UniProt ID | Q9FUT3 |
◆ Recombinant Proteins | ||
FBXW7-2448H | Recombinant Human FBXW7 Protein, His-tagged | +Inquiry |
IGFBP1-2491H | Recombinant Human IGFBP1 Protein (Ala26-Asn259), N-His tagged | +Inquiry |
PILRB2-12814M | Recombinant Mouse PILRB2 Protein | +Inquiry |
BTN2A2-9591HFL | Recombinant Full Length Human BTN2A2 protein, Flag-tagged | +Inquiry |
CCNH-1288H | Recombinant Human CCNH Protein (Met1-Leu323), N-His tagged | +Inquiry |
◆ Native Proteins | ||
IgA-259H | Native Human Secretory Immunoglobulin A | +Inquiry |
TTR-706H | Native Human Transthyretin | +Inquiry |
C6-55H | Native Human Complement C6 | +Inquiry |
CRP-8059R | Native Rat Serum C-Reactive Protein | +Inquiry |
Lectin-1836R | Native Ricinus Communis Ricin B Chain Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
C2orf15-8087HCL | Recombinant Human C2orf15 293 Cell Lysate | +Inquiry |
ORM1-3549HCL | Recombinant Human ORM1 293 Cell Lysate | +Inquiry |
SIRPB1-1608HCL | Recombinant Human SIRPB1 cell lysate | +Inquiry |
ADH1C-9013HCL | Recombinant Human ADH1C 293 Cell Lysate | +Inquiry |
RNF14-2296HCL | Recombinant Human RNF14 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ABCB23 Products
Required fields are marked with *
My Review for All ABCB23 Products
Required fields are marked with *
0
Inquiry Basket