Recombinant Full Length Arabidopsis Thaliana 3Beta-Hydroxysteroid-Dehydrogenase/Decarboxylase Isoform 2(3Betahsd/D2) Protein, His-Tagged
Cat.No. : | RFL2134AF |
Product Overview : | Recombinant Full Length Arabidopsis thaliana 3beta-hydroxysteroid-dehydrogenase/decarboxylase isoform 2(3BETAHSD/D2) Protein (Q67ZE1) (1-564aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Arabidopsis thaliana |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-564) |
Form : | Lyophilized powder |
AA Sequence : | MSPAATETERWCVVTGGRGFAARHLVEMLVRYEMFCVRIADLAPAIMLDPQEGNGVLDEG LRSGRVQYISADLRDKSQVVKAFQGAEVVFHMAAPDSSINNHQLQYSVNVQGTQNVIDAC VDVGVKRLIYTSSPSVVFDGVHGILNGTESMAYPIKHNDSYSATKAEGEELIMKANGRNG LLTCCIRPSSIFGPGDRLLVPSLVAAARAGKSKFIIGDGNNLYDFTYVENVAHAHVCAER ALASGGDVSTKAAGQAYFITNMEPIKFWEFMSQLLDGLGYERPSIKIPAFIMMPIAHLVE LTYKVLGPYGMTVPQLTPSRVRLLSCSRTFDSTKAKDRLGYAPVVPLQEGIRRTIDSFSH LTAGSQSKREGPSKASRILGGGKVADTLLWKDLKQTLIAIFILISIYYNFVATGSTVVTA LSKALLVASVFLFLHGILPEKIFGYTVEKIPASQFHLSKDSSHDLSLSVISSWNTTVKAL RSLCQGNDWSFFFKVVFVLLALSLAGAISLHSIFVIGLPIAFLAFLVYEKKEQEIDSIVV SFKSFACKHKSDVYEKLFGSKKHD |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | 3BETAHSD/D2 |
Synonyms | 3BETAHSD/D2; RTNLB19; At2g26260; T1D16.10; 3beta-hydroxysteroid-dehydrogenase/decarboxylase isoform 2; At3BETAHSD/D2; 4alpha-carboxysterol-C3-dehydrogenase/C4-decarboxylase isoform 1-2; Reticulon-like protein B19; AtRTNLB19; Sterol-4-alpha-carboxylate 3-d |
UniProt ID | Q67ZE1 |
◆ Recombinant Proteins | ||
CTSK-333R | Recombinant Rhesus monkey CTSK Protein, His-tagged | +Inquiry |
USO1-9945M | Recombinant Mouse USO1 Protein, His (Fc)-Avi-tagged | +Inquiry |
PFKM-4395R | Recombinant Rat PFKM Protein | +Inquiry |
SAP049A-033-4342S | Recombinant Staphylococcus aureus (strain: NE 3868) SAP049A_033 protein, His-tagged | +Inquiry |
ALKBH7-9588H | Recombinant Human ALKBH7 protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
APOB-613H | Native Human Apolipoprotein B (including Ag(x) antigen) | +Inquiry |
FGB-46P | Native Porcine Fibrinogen, FITC Labeled | +Inquiry |
BGLAP-57H | Native Human Osteocalcin | +Inquiry |
Lectin-1761A | Active Native Agaricus bisporus lectin Protein, Fluorescein labeled | +Inquiry |
Hyaluronidase-35O | Active Native Ovine Hyaluronidase, 300U/mg | +Inquiry |
◆ Cell & Tissue Lysates | ||
AGPS-8973HCL | Recombinant Human AGPS 293 Cell Lysate | +Inquiry |
SUSD4-787HCL | Recombinant Human SUSD4 cell lysate | +Inquiry |
ECEL1-6731HCL | Recombinant Human ECEL1 293 Cell Lysate | +Inquiry |
FAM70B-6357HCL | Recombinant Human FAM70B 293 Cell Lysate | +Inquiry |
PTCRA-515HCL | Recombinant Human PTCRA lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All 3BETAHSD/D2 Products
Required fields are marked with *
My Review for All 3BETAHSD/D2 Products
Required fields are marked with *
0
Inquiry Basket