Recombinant Full Length Arabidopsis Thaliana 3-Ketoacyl-Coa Synthase 9(Kcs9) Protein, His-Tagged
Cat.No. : | RFL36827AF |
Product Overview : | Recombinant Full Length Arabidopsis thaliana 3-ketoacyl-CoA synthase 9(KCS9) Protein (Q9SIX1) (1-512aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Arabidopsis thaliana |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-512) |
Form : | Lyophilized powder |
AA Sequence : | MEAANEPVNGGSVQIRTENNERRKLPNFLQSVNMKYVKLGYHYLITHLFKLCLVPLMAVL VTEISRLTTDDLYQIWLHLQYNLVAFIFLSALAIFGSTVYIMSRPRSVYLVDYSCYLPPE SLQVKYQKFMDHSKLIEDFNESSLEFQRKILERSGLGEETYLPEALHCIPPRPTMMAARE ESEQVMFGALDKLFENTKINPRDIGVLVVNCSLFNPTPSLSAMIVNKYKLRGNVKSFNLG GMGCSAGVISIDLAKDMLQVHRNTYAVVVSTENITQNWYFGNKKAMLIPNCLFRVGGSAI LLSNKGKDRRRSKYKLVHTVRTHKGAVEKAFNCVYQEQDDNGKTGVSLSKDLMAIAGEAL KANITTLGPLVLPISEQILFFMTLVTKKLFNSKLKPYIPDFKLAFDHFCIHAGGRAVIDE LEKNLQLSQTHVEASRMTLHRFGNTSSSSIWYELAYIEAKGRMKKGNRVWQIAFGSGFKC NSAVWVALNNVKPSVSSPWEHCIDRYPVKLDF |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | KCS9 |
Synonyms | KCS9; At2g16280; F16F14.22; 3-ketoacyl-CoA synthase 9; KCS-9; Very long-chain fatty acid condensing enzyme 9; VLCFA condensing enzyme 9 |
UniProt ID | Q9SIX1 |
◆ Recombinant Proteins | ||
KPHS_03330-158K | Recombinant Klebsiella pneumoniae KPHS_03330 Protein | +Inquiry |
RFL19849MF | Recombinant Full Length Mouse Cortexin-1(Ctxn1) Protein, His-Tagged | +Inquiry |
Cpb1-3286M | Active Recombinant Mouse Cpb1 protein, His-tagged | +Inquiry |
Trip6-639M | Recombinant Mouse Trip6 Protein, His/GST-tagged | +Inquiry |
IL18-1575H | Active Recombinant Human IL18 protein, Fc-tagged | +Inquiry |
◆ Native Proteins | ||
HB-44R | Native Rabbit Hemoglobin (HB) Protein | +Inquiry |
PTI-29B | Active Native Bovine Aprotinin | +Inquiry |
CTSS-27405TH | Native Human CTSS | +Inquiry |
Complement C4-50H | Native Human Complement C4 | +Inquiry |
SV40gp6-268 | Active Native Simian virus 40 SV40gp6 protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
UBQLN1-546HCL | Recombinant Human UBQLN1 293 Cell Lysate | +Inquiry |
PCDHB6-3390HCL | Recombinant Human PCDHB6 293 Cell Lysate | +Inquiry |
Bladder-718P | Pig Bladder Lysate, Total Protein | +Inquiry |
FAM207A-8096HCL | Recombinant Human C21orf70 293 Cell Lysate | +Inquiry |
EHD2-6690HCL | Recombinant Human EHD2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All KCS9 Products
Required fields are marked with *
My Review for All KCS9 Products
Required fields are marked with *
0
Inquiry Basket