Recombinant Full Length Arabidopsis Thaliana 3-Ketoacyl-Coa Synthase 10(Fdh) Protein, His-Tagged
Cat.No. : | RFL10545AF |
Product Overview : | Recombinant Full Length Arabidopsis thaliana 3-ketoacyl-CoA synthase 10(FDH) Protein (Q570B4) (1-550aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Arabidopsis thaliana |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-550) |
Form : | Lyophilized powder |
AA Sequence : | MGRSNEQDLLSTEIVNRGIEPSGPNAGSPTFSVRVRRRLPDFLQSVNLKYVKLGYHYLIN HAVYLATIPVLVLVFSAEVGSLSREEIWKKLWDYDLATVIGFFGVFVLTACVYFMSRPRS VYLIDFACYKPSDEHKVTKEEFIELARKSGKFDEETLGFKKRILQASGIGDETYVPRSIS SSENITTMKEGREEASTVIFGALDELFEKTRVKPKDVGVLVVNCSIFNPTPSLSAMVINH YKMRGNILSYNLGGMGCSAGIIAIDLARDMLQSNPNSYAVVVSTEMVGYNWYVGSDKSMV IPNCFFRMGCSAVMLSNRRRDFRHAKYRLEHIVRTHKAADDRSFRSVYQEEDEQGFKGLK ISRDLMEVGGEALKTNITTLGPLVLPFSEQLLFFAALLRRTFSPAAKTSTTTSFSTSATA KTNGIKSSSSDLSKPYIPDYKLAFEHFCFHAASKVVLEELQKNLGLSEENMEASRMTLHR FGNTSSSGIWYELAYMEAKESVRRGDRVWQIAFGSGFKCNSVVWKAMRKVKKPTRNNPWV DCINRYPVPL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | FDH |
Synonyms | FDH; EL4; KCS10; At2g26250; T1D16.11; 3-ketoacyl-CoA synthase 10; KCS-10; Protein FIDDLEHEAD; Very long-chain fatty acid condensing enzyme 10; VLCFA condensing enzyme 10 |
UniProt ID | Q570B4 |
◆ Recombinant Proteins | ||
ACVR2B-171H | Recombinant Human ACVR2B Protein, Fc\His-tagged | +Inquiry |
UL99-1032V | Recombinant Cytomegalovirus UL99 Protein | +Inquiry |
RFL19048XF | Recombinant Full Length Xenopus Laevis Zinc Transporter 8(Slc30A8) Protein, His-Tagged | +Inquiry |
sialic acid lyase-1407S | Recombinant Staphylococcus haemolyticus sialic acid lyase Protein (M1-L293) | +Inquiry |
TMEM191C-1786H | Recombinant Human TMEM191C | +Inquiry |
◆ Native Proteins | ||
CHC-001C | Native Clostridium Histolyticum Collagenase, Tag Free | +Inquiry |
Stomach-004H | Human Stomach Lysate, Total Protein | +Inquiry |
MHC-239H | Native Human Myosin Heavy Chain | +Inquiry |
CA 19-9-378H | Active Native Human Cancer Antigen 19-9 | +Inquiry |
TNC-50H | Native Human Tenascin C | +Inquiry |
◆ Cell & Tissue Lysates | ||
RIT1-2330HCL | Recombinant Human RIT1 293 Cell Lysate | +Inquiry |
SIT1-1827HCL | Recombinant Human SIT1 293 Cell Lysate | +Inquiry |
RPL3-2208HCL | Recombinant Human RPL3 293 Cell Lysate | +Inquiry |
Lung-306H | Human Lung (LT Upper Lobe) Membrane Lysate | +Inquiry |
SNRPB2-1615HCL | Recombinant Human SNRPB2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All FDH Products
Required fields are marked with *
My Review for All FDH Products
Required fields are marked with *
0
Inquiry Basket