Recombinant Full Length Arabidopsis Thaliana 15-Cis-Zeta-Carotene Isomerase, Chloroplastic(Z-Iso) Protein, His-Tagged
Cat.No. : | RFL1277AF |
Product Overview : | Recombinant Full Length Arabidopsis thaliana 15-cis-zeta-carotene isomerase, chloroplastic(Z-ISO) Protein (Q9SAC0) (59-367aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Arabidopsis thaliana |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (59-367) |
Form : | Lyophilized powder |
AA Sequence : | STLREDQPIASDSESSPTLLIGEDSAAFELGKQKLVSWVYFGVVLGVVLFILNVVWIDNS TGFGKSFIDAVSNISGSPEVAMLMLILIFAIVHSGLASLRDIGEKLIGERAFRVLFAGIS LPLAMSTIVYFINHRYDGSQLWQLQGVPGVHEAIWVANFVSFFFLYPSTFNLLEVAAVDK PKMHLWETGIMRITRHPQMVGQIVWCLAHTLWIGNTVAASASLGLIAHHLFGAWNGDRRL AKRYGEDFESIKKRTSVIPFAAIFEGRQVLPEDYYKEFVRLPYLAITALTVGAYFAHPLM QGASFRLHW |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Z-ISO |
Synonyms | Z-ISO; At1g10830; T16B5.3; 15-cis-zeta-carotene isomerase, chloroplastic |
UniProt ID | Q9SAC0 |
◆ Recombinant Proteins | ||
Hspa5-1639R | Recombinant Rat Hspa5 Protein, His-tagged | +Inquiry |
ARG2-1186HF | Recombinant Full Length Human ARG2 Protein, GST-tagged | +Inquiry |
MTMR7A-3753Z | Recombinant Zebrafish MTMR7A | +Inquiry |
GSK3A-2381R | Recombinant Rat GSK3A Protein, His (Fc)-Avi-tagged | +Inquiry |
CD274-1283H | Recombinant Human CD274 protein, His-Avi-tagged, Biotinylated | +Inquiry |
◆ Native Proteins | ||
IgG-017R | Native Rabbit IgG Isotype Control, R-Phycoerythrin Conjugated | +Inquiry |
cpe-001C | Active Native C. perfringens Enterotoxin | +Inquiry |
IgG-350R | Native RAT Gamma Globulin Fraction | +Inquiry |
MBLG-167B | Native Bovine milk β-Lactoglobulin | +Inquiry |
Clostripain-02C | Native Clostridium histolyticum Clostripain, Sequencing Grade | +Inquiry |
◆ Cell & Tissue Lysates | ||
MAPK15-1058HCL | Recombinant Human MAPK15 cell lysate | +Inquiry |
RTKN2-1377HCL | Recombinant Human RTKN2 cell lysate | +Inquiry |
ATG14-360HCL | Recombinant Human ATG14 lysate | +Inquiry |
SCGB2B2-2035HCL | Recombinant Human SCGBL 293 Cell Lysate | +Inquiry |
MET-1931CCL | Recombinant Canine MET cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Z-ISO Products
Required fields are marked with *
My Review for All Z-ISO Products
Required fields are marked with *
0
Inquiry Basket