Recombinant Full Length Aquifex Aeolicus Uncharacterized Protein Aq_1917 (Aq_1917) Protein, His-Tagged
Cat.No. : | RFL21435AF |
Product Overview : | Recombinant Full Length Aquifex aeolicus Uncharacterized protein aq_1917 (aq_1917) Protein (O67748) (1-345aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Aquifex Aeolicus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-345) |
Form : | Lyophilized powder |
AA Sequence : | MEAQAGFDTFIEATRYLFRGPSPQEILLLIIVLGALITVVSLPFFYSKLKEKQRIRENFF RRARDFDLTEEEASVLWKYVKETVLNPNLVFENKAVFEKVVDRIVQNGNPEEIKLISSIR MKLRFSSLPWFIPLTSTRDIEVYQTGVLVVRNRRVDAYVYDKDEEFLYIALLEPVVVKPG ERVSFFFLRENDARYSFDATVEKVFNEGGRTVIVVRHTSEIKRIQLRESVRWKVKLPVKF TLLKENGEEINAEGQLEDISVKGARVCFEGRLDIKEGDRILLDFTLKNYTFKNLLGTVVH QIVYEKRTCLGIKFEELSRKEEEVIGQFILEEQRKLLKAYKEGEV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | aq_1917 |
Synonyms | aq_1917; Uncharacterized protein aq_1917 |
UniProt ID | O67748 |
◆ Recombinant Proteins | ||
RFL23741BF | Recombinant Full Length Bovine Uncharacterized Protein C1Orf43 Homolog Protein, His-Tagged | +Inquiry |
SRSF4-26856TH | Recombinant Human SRSF4 | +Inquiry |
PDK3-1072H | Active Recombinant Human PDK3, GST-tagged | +Inquiry |
DKK1-276H | Active Recombinant Human DKK1 protein | +Inquiry |
HOMER3-13881H | Recombinant Human HOMER3, His-tagged | +Inquiry |
|
◆ Native Proteins | ||
IgA-7430M | Active Native Mouse IgA Kappa Protein | +Inquiry |
Compound E-12 | Compound E, Antibotics Free | +Inquiry |
IgG-336S | Native Sheep Gamma Globulin Fraction | +Inquiry |
SERPINC1-8032H | Native Human Plasma AntiThromblin III | +Inquiry |
Lectin-1815P | Active Native Peanut Lectin Protein, Cy5 labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
Placenta-650B | Bovine Placenta Lysate, Total Protein | +Inquiry |
TMEM173-988HCL | Recombinant Human TMEM173 293 Cell Lysate | +Inquiry |
TEX35-98HCL | Recombinant Human TEX35 lysate | +Inquiry |
BBS12-248HCL | Recombinant Human BBS12 cell lysate | +Inquiry |
GAL-759HCL | Recombinant Human GAL cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All aq_1917 Products
Required fields are marked with *
My Review for All aq_1917 Products
Required fields are marked with *
0
Inquiry Basket