Recombinant Full Length Aquifex Aeolicus Uncharacterized Protein Aq_1900 (Aq_1900) Protein, His-Tagged
Cat.No. : | RFL2461AF |
Product Overview : | Recombinant Full Length Aquifex aeolicus Uncharacterized protein aq_1900 (aq_1900) Protein (O67738) (1-168aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Aquifex Aeolicus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-168) |
Form : | Lyophilized powder |
AA Sequence : | MKRIIALLFFFLIAFGYSLSPEEEKQLIRDIAEIKATLKTFMEQTDKRFQDLNQRINELR EDMNKRFEQVDKRFEQVDKRFEQINNELNRLIQIMVGIFAGQIALVAAVIGFAWWDRRTI IRKSKEETFEEMEKELRPEKFKKLLNALREKAKTDKELEAILKKYGLL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | aq_1900 |
Synonyms | aq_1900; Uncharacterized protein aq_1900 |
UniProt ID | O67738 |
◆ Recombinant Proteins | ||
SNAI3-4172R | Recombinant Rhesus Macaque SNAI3 Protein, His (Fc)-Avi-tagged | +Inquiry |
GDF15-338H | Recombinant Human GDF15 Protein, His tagged | +Inquiry |
MINPP1-1412H | Recombinant Human MINPP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
C6-712R | Recombinant Rat C6 Protein, His (Fc)-Avi-tagged | +Inquiry |
IDH2-2192R | Recombinant Rhesus monkey IDH2 Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
GG-189S | Native Sheep Gamma Globulin protein | +Inquiry |
ACTC1-852B | Native Bovine ACTC1 Protein | +Inquiry |
Trypsin-251H | Active Native Human Trypsin | +Inquiry |
TTR-155B | Native Bovine Prealbumin protein | +Inquiry |
IgG-013L | Native Llama IgG, Protein G Purified | +Inquiry |
◆ Cell & Tissue Lysates | ||
MARK1-4465HCL | Recombinant Human MARK1 293 Cell Lysate | +Inquiry |
Appendix-20C | Cynomolgus monkey Appendix Lysate | +Inquiry |
TCEB2-1188HCL | Recombinant Human TCEB2 293 Cell Lysate | +Inquiry |
IL10RB-2677HCL | Recombinant Human IL10RB cell lysate | +Inquiry |
PAX3-3418HCL | Recombinant Human PAX3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All aq_1900 Products
Required fields are marked with *
My Review for All aq_1900 Products
Required fields are marked with *
0
Inquiry Basket