Recombinant Full Length Aquifex Aeolicus Uncharacterized Protein Aq_1446 (Aq_1446) Protein, His-Tagged
Cat.No. : | RFL18911AF |
Product Overview : | Recombinant Full Length Aquifex aeolicus Uncharacterized protein aq_1446 (aq_1446) Protein (O67433) (1-185aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Aquifex Aeolicus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-185) |
Form : | Lyophilized powder |
AA Sequence : | MMKFLLILIFLASFSFSLTPEEEKQLLKDIAEIKTTLKAFIREADERFEQVDKRFEDVNR RFEDFNRRLNDLREDMNKRFELVDKRFIELREDMNKRFELVDQRFEQLYTFLWIITGIFT TLTASVIAFAWWDRRTIIRKTKEETFEEMEKELKPEKFRKIMNALREKAKTDKELEAILK KYGLL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | aq_1446 |
Synonyms | aq_1446; Uncharacterized protein aq_1446 |
UniProt ID | O67433 |
◆ Recombinant Proteins | ||
PPA2-13153M | Recombinant Mouse PPA2 Protein | +Inquiry |
CD151-3035M | Recombinant Mouse CD151 Protein | +Inquiry |
MUTED-6580HF | Recombinant Full Length Human MUTED Protein, GST-tagged | +Inquiry |
Ndufaf1-4335M | Recombinant Mouse Ndufaf1 Protein, Myc/DDK-tagged | +Inquiry |
SNX18-2859H | Recombinant Human SNX18, His-tagged | +Inquiry |
◆ Native Proteins | ||
APOC1-616H | Native Human Apolipoprotein C-I | +Inquiry |
THBS1-31514TH | Native Human THBS1 | +Inquiry |
GLDH-213B | Active Native Bovine Glutamate Dehydrogenase | +Inquiry |
Immunoglobulin G2-82H | Native Human Immunoglobulin G2 | +Inquiry |
IgA2-211H | Native Human Immunoglobulin A2 (IgA2) | +Inquiry |
◆ Cell & Tissue Lysates | ||
DOK3-506HCL | Recombinant Human DOK3 cell lysate | +Inquiry |
THTPA-1086HCL | Recombinant Human THTPA 293 Cell Lysate | +Inquiry |
PDGFRB-1107HCL | Recombinant Human PDGFRB cell lysate | +Inquiry |
Spleen-790D | Dog Spleen Membrane Lysate, Total Protein | +Inquiry |
RPP30-2179HCL | Recombinant Human RPP30 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All aq_1446 Products
Required fields are marked with *
My Review for All aq_1446 Products
Required fields are marked with *
0
Inquiry Basket