Recombinant Full Length Aquifex Aeolicus Uncharacterized Protein Aq_1188 (Aq_1188) Protein, His-Tagged
Cat.No. : | RFL27567AF |
Product Overview : | Recombinant Full Length Aquifex aeolicus Uncharacterized protein aq_1188 (aq_1188) Protein (O67248) (1-155aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Aquifex Aeolicus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-155) |
Form : | Lyophilized powder |
AA Sequence : | MTFLFLILVFIIEILQLSVFPPIFGNAYIVPSLAFLLVLFSSYKIKEKALLLAFLSGLFY DAVVNFLGFISLLNVVFTYLYLVLNNILFVKNPKVEVFLIMPLILLLRKLTIFLVVNTKF PLNIGLKDFGVVLLIDLIFLILLYKVFNKYVYEKA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | aq_1188 |
Synonyms | aq_1188; Uncharacterized protein aq_1188 |
UniProt ID | O67248 |
◆ Recombinant Proteins | ||
SEBOX-1029H | Recombinant Human SEBOX | +Inquiry |
L2-1733H | Recombinant HPV-6 L2 Protein | +Inquiry |
ITIH4-4393H | Recombinant Human ITIH4 protein, His-SUMO-tagged | +Inquiry |
CROT-5783H | Recombinant Human CROT Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
ICAM1-799H | Recombinant Human ICAM1 Protein, MYC/DDK-tagged | +Inquiry |
◆ Native Proteins | ||
F10-267B | Active Native Bovine Factor X | +Inquiry |
Y. enterocolitica-29 | Native Yersinia enterocolitica O:3 Antigen | +Inquiry |
IgA-243C | Native Cat Immunoglobulin A | +Inquiry |
Collagen-59C | Native Chicken Collagen Type II | +Inquiry |
Collagen Type I-05H | Native Human Collagen Type I | +Inquiry |
◆ Cell & Tissue Lysates | ||
EFHA1-6703HCL | Recombinant Human EFHA1 293 Cell Lysate | +Inquiry |
C1RL-8132HCL | Recombinant Human C1RL 293 Cell Lysate | +Inquiry |
A-172-029HCL | Human A-172 Whole Cell Lysate | +Inquiry |
Bladder-33R | Rat Bladder Membrane Lysate | +Inquiry |
C8orf4-131HCL | Recombinant Human C8orf4 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All aq_1188 Products
Required fields are marked with *
My Review for All aq_1188 Products
Required fields are marked with *
0
Inquiry Basket