Recombinant Full Length Aquifex Aeolicus Uncharacterized Mscs Family Protein Aq_812 (Aq_812) Protein, His-Tagged
Cat.No. : | RFL9347AF |
Product Overview : | Recombinant Full Length Aquifex aeolicus Uncharacterized MscS family protein aq_812 (aq_812) Protein (O66994) (1-368aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Aquifex Aeolicus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-368) |
Form : | Lyophilized powder |
AA Sequence : | MEEILIWIKKLEKYLYALNAKVAGIPLYKIIIASAIMLFTLILRRLIAFLIVKILTKLTI RTKTDVDELIVKAFVKPFSYFIVVFGFYLSLLVLEVPKVYADKFLKTFSLLILGWAIIRF LNLFHNKIVEFFVKVGGKDFAEEVGDFILKILKAFVVVIVGASLLQEWGVNIGAILASVG LLGLAVSLAAKDTFENILSGLIILLDKPVKVGETVKVKDFMGSVEDIGLRSTKIRTFDKS LVTIPNRDIVNNHVENFTRRNKRRVRFYIGVVYSTKREQLENILKEIRELLKEHPGVAKD EKFYVYFENYGDSSLNILIQYYANTNDYEEYLKIIEDINLKIMEIVEKNGSSFAFPSRSV YIEKMPKS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | aq_812 |
Synonyms | aq_812; Uncharacterized MscS family protein aq_812 |
UniProt ID | O66994 |
◆ Native Proteins | ||
PLG-30880TH | Native Human PLG | +Inquiry |
FSH-93P | Active Native Porcine FSH | +Inquiry |
Pectin-008A | Native Apple or Citrus fruits Pectin | +Inquiry |
Prothrombin-58M | Native Mouse Prothrombin | +Inquiry |
Ferritin-179H | Native Human Ferritin | +Inquiry |
◆ Cell & Tissue Lysates | ||
TBL3-1211HCL | Recombinant Human TBL3 293 Cell Lysate | +Inquiry |
SLC22A6-1793HCL | Recombinant Human SLC22A6 293 Cell Lysate | +Inquiry |
Seminal-625R | Rat Seminal Vesicles Lysate, Total Protein | +Inquiry |
PLAC8L1-3135HCL | Recombinant Human PLAC8L1 293 Cell Lysate | +Inquiry |
DTD1-6802HCL | Recombinant Human DTD1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All aq_812 Products
Required fields are marked with *
My Review for All aq_812 Products
Required fields are marked with *
0
Inquiry Basket