Recombinant Full Length Aquifex Aeolicus Putative Zinc Metalloprotease Aq_1964 (Aq_1964) Protein, His-Tagged
Cat.No. : | RFL15006AF |
Product Overview : | Recombinant Full Length Aquifex aeolicus Putative zinc metalloprotease aq_1964 (aq_1964) Protein (O67776) (1-429aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Aquifex Aeolicus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-429) |
Form : | Lyophilized powder |
AA Sequence : | MGLIAFLILIGVLVWVHEFGHFLMAKLFRVKVEIFSIGFGPPIFRRQWGETVYQIAALPL GGYVKLYGEEENVHDPRAFSTKKPWQKILIALGGPLFNFLFTILVFALVYTAGVEVPKYL KEPVVVGYVQRDSIAQKIGIKPGDKIIKINGYEVRTWEDLRDALIRLSLDGVKETTLFLE RNGEVLHLTIKVPNVQKGEELGIAPLVKPVVGGVKKGSPADQVGIKPGDLILEVNGKKIN TWYELVEEVRKSQGKAIKLKILRNGKMIEKELIPAKDPKTGTYFIGLFPKTETVVEKKPF GEALASAVNRTWELTVLTLKTIAGLITGKVSFQTLGGPIAIAQIAGQAAQSGFIPYLVMM AFISLQLGIFNLIPLPILDGGLILLFAIEWLRGRPLPEKFKEYWQRVGLAIIITLTIFVF INDILRLLR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | aq_1964 |
Synonyms | aq_1964; Putative zinc metalloprotease aq_1964 |
UniProt ID | O67776 |
◆ Native Proteins | ||
HP-200H | Native Human Haptoglobin | +Inquiry |
LH-12P | Native Porcine Luteinizing Hormone Protein | +Inquiry |
RNase-43B | Active Native Bovine Ribonuclease | +Inquiry |
PAP-01H | Active Native Human PAP | +Inquiry |
FGF2-26551TH | Native Human FGF2 | +Inquiry |
◆ Cell & Tissue Lysates | ||
FCRL1-2227HCL | Recombinant Human FCRL1 cell lysate | +Inquiry |
SNX6-1586HCL | Recombinant Human SNX6 293 Cell Lysate | +Inquiry |
CENPI-334HCL | Recombinant Human CENPI cell lysate | +Inquiry |
GLRX2-714HCL | Recombinant Human GLRX2 cell lysate | +Inquiry |
HA-2325HCL | Recombinant H16N3 HA cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All aq_1964 Products
Required fields are marked with *
My Review for All aq_1964 Products
Required fields are marked with *
0
Inquiry Basket