Recombinant Full Length Apis Mellifera Rhodopsin, Long-Wavelength Protein, His-Tagged
Cat.No. : | RFL16032AF |
Product Overview : | Recombinant Full Length Apis mellifera Rhodopsin, long-wavelength Protein (Q17053) (1-377aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Honey bee |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-377) |
Form : | Lyophilized powder |
AA Sequence : | MIAVSGPSYEAFSYGGQARFNNQTVVDKVPPDMLHLIDANWYQYPPLNPMWHGILGFVIG MLGFVSAMGNGMVVYIFLSTKSLRTPSNLFVINLAISNFLMMFCMSPPMVINCYYETWVL GPLFCQIYAMLGSLFGCGSIWTMTMIAFDRYNVIVKGLSGKPLSINGALIRIIAIWLFSL GWTIAPMFGWNRYVPEGNMTACGTDYFNRGLLSASYLVCYGIWVYFVPLFLIIYSYWFII QAVAAHEKNMREQAKKMNVASLRSSENQNTSAECKLAKVALMTISLWFMAWTPYLVINFS GIFNLVKISPLFTIWGSLFAKANAVYNPIVYGISHPKYRAALFAKFPSLACAAEPSSDAV STTSGTTTVTDNEKSNA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Apis mellifera Rhodopsin, long-wavelength |
Synonyms | Rhodopsin, long-wavelength; Opsin, green-sensitive |
UniProt ID | Q17053 |
◆ Recombinant Proteins | ||
ESPL1-5323M | Recombinant Mouse ESPL1 Protein | +Inquiry |
Il21-001H | Active Recombinant Human Il21, HIgG1 Fc-tagged, mutant | +Inquiry |
RFL29977CF | Recombinant Full Length Chlorobium Limicola Protease Htpx Homolog(Htpx) Protein, His-Tagged | +Inquiry |
TXNIP-3645H | Recombinant Human TXNIP protein, GST-tagged | +Inquiry |
LRRC15-1518C | Recombinant Canine LRRC15 protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
Proteoglycans-52H | Native Human Proteoglycans | +Inquiry |
Thrombin-25H | Active Native Human β-thrombin | +Inquiry |
CAT-1847B | Active Native Bovine, Catalase | +Inquiry |
Hb-001H | Native Human Hb Protein | +Inquiry |
PLG-1867B | Native Bovine PLG Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
LRRC52-4624HCL | Recombinant Human LRRC52 293 Cell Lysate | +Inquiry |
PIANP-1461HCL | Recombinant Human PIANP cell lysate | +Inquiry |
CTF1-001HCL | Recombinant Human CTF1 cell lysate | +Inquiry |
EVA1A-263HCL | Recombinant Human EVA1A lysate | +Inquiry |
ZWINT-9179HCL | Recombinant Human ZWINT 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All Apis mellifera Rhodopsin, long-wavelength Products
Required fields are marked with *
My Review for All Apis mellifera Rhodopsin, long-wavelength Products
Required fields are marked with *
0
Inquiry Basket