Recombinant Full Length Antirrhinum Majus Photosystem Ii D2 Protein(Psbd) Protein, His-Tagged
Cat.No. : | RFL17861AF |
Product Overview : | Recombinant Full Length Antirrhinum majus Photosystem II D2 protein(psbD) Protein (P69685) (1-353aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Antirrhinum majus (Garden snapdragon) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-353) |
Form : | Lyophilized powder |
AA Sequence : | MTIALGKFTKDENDLFDIMDDWLRRDRFVFVGWSGLLLFPCAYFAVGGWFTGTTFVTSWY THGLASSYLEGCNFLTAAVSTPANSLAHSLLLLWGPEAQGDFTRWCQLGGLWTFVALHGA FGLIGFMLRQFELARSVQLRPYNAIAFSGPIAVFVSVFLIYPLGQSGWFFAPSFGVAAIF RFILFFQGFHNWTLNPFHMMGVAGVLGAALLCAIHGATVENTLFEDGDGANTFRAFNPTQ AEETYSMVTANRFWSQIFGVAFSNKRWLHFFMLFVPVTGLWMSALGVVGLALNLRAYDFV SQEIRAAEDPEFETFYTKNILLNEGIRAWMAAQDQPHENLIFPEEVLPRGNAL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | psbD |
Synonyms | psbD; Photosystem II D2 protein; PSII D2 protein; Photosystem Q(A protein |
UniProt ID | P69685 |
◆ Recombinant Proteins | ||
Aff2-3231M | Recombinant Mouse Aff2, His-tagged | +Inquiry |
ABCE1-1580C | Recombinant Chicken ABCE1 | +Inquiry |
BCAP29-1686HFL | Recombinant Full Length Human BCAP29 Protein, C-Flag-tagged | +Inquiry |
DLK1-26914TH | Recombinant Human DLK1, Fc-tagged | +Inquiry |
CD99L2-1268R | Recombinant Rat CD99L2 Protein | +Inquiry |
◆ Native Proteins | ||
Factor D-61H | Native Human Factor D | +Inquiry |
IgG-346D | Native Dog Gamma Globulin Fraction | +Inquiry |
GPT-26879TH | Native Human GPT | +Inquiry |
GALT-10 | Active Native Streptoverticillium mobaraense | +Inquiry |
Hemoglobin F-034H | Native Human Hemoglobin F Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
NELL2-468HCL | Recombinant Human NELL2 cell lysate | +Inquiry |
DNAI1-6896HCL | Recombinant Human DNAI1 293 Cell Lysate | +Inquiry |
GTDC1-5706HCL | Recombinant Human GTDC1 293 Cell Lysate | +Inquiry |
TOM1L2-1808HCL | Recombinant Human TOM1L2 cell lysate | +Inquiry |
HSD11B2-5378HCL | Recombinant Human HSD11B2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All psbD Products
Required fields are marked with *
My Review for All psbD Products
Required fields are marked with *
0
Inquiry Basket