Recombinant Human TMEM242 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : TMEM242-2217H
Product Overview : C6orf35 MS Standard C13 and N15-labeled recombinant protein (NP_060922) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : TMEM242 (Transmembrane Protein 242) is a Protein Coding gene. Diseases associated with TMEM242 include Chromosome 3Pter-P25 Deletion Syndrome and Familial Isolated Trichomegaly.
Molecular Mass : 14.8 kDa
AA Sequence : METAGAATGQPASGLEAPGSTNDRLFLVKGGIFLGTVAAAGMLAGFITTLSLAKKKSPEWFNKGSMATAALPESGSSLALRALGWGSLYAWCGVGVISFAVWKALGVHSMNDFRSKMQSIFPTIPKNSESAVEWEETLKSKTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name TMEM242 transmembrane protein 242 [ Homo sapiens (human) ]
Official Symbol TMEM242
Synonyms TMEM242; transmembrane protein 242; BM033; C6orf35; transmembrane protein 242; UPF0463 transmembrane protein C6orf35
Gene ID 729515
mRNA Refseq NM_018452
Protein Refseq NP_060922
UniProt ID Q9NWH2

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All TMEM242 Products

Required fields are marked with *

My Review for All TMEM242 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon