Recombinant Human TMEM242 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: TMEM242-2217H
• Product Overview: C6orf35 MS Standard C13 and N15-labeled recombinant protein (NP_060922) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: TMEM242 (Transmembrane Protein 242) is a Protein Coding gene. Diseases associated with TMEM242 include Chromosome 3Pter-P25 Deletion Syndrome and Familial Isolated Trichomegaly.
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 14.8 kDa
• AA Sequence: METAGAATGQPASGLEAPGSTNDRLFLVKGGIFLGTVAAAGMLAGFITTLSLAKKKSPEWFNKGSMATAALPESGSSLALRALGWGSLYAWCGVGVISFAVWKALGVHSMNDFRSKMQSIFPTIPKNSESAVEWEETLKSKTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: TMEM242 transmembrane protein 242 [ Homo sapiens (human) ]
• Official Symbol: TMEM242
• Synonyms: TMEM242; transmembrane protein 242; BM033; C6orf35; transmembrane protein 242; UPF0463 transmembrane protein C6orf35
• Gene ID: 729515
• mRNA Refseq: NM_018452
• Protein Refseq: NP_060922
• UniProt ID: Q9NWH2