Recombinant Full Length Anopheles Gambiae Gustatory And Odorant Receptor 22(Gprgr22) Protein, His-Tagged
Cat.No. : | RFL1898AF |
Product Overview : | Recombinant Full Length Anopheles gambiae Gustatory and odorant receptor 22(GPRgr22) Protein (Q7PMG3) (1-467aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Anopheles gambiae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-467) |
Form : | Lyophilized powder |
AA Sequence : | MIHTQMEDAQYEIRHQVLNPNQRQQLEDRRRIKEQLHQLEQDNESPTHMYRRKLKIASDV NLLDQHDSFYHTTKSLLVLFQIMGVMPIMRSPKGVDMPRTTFTWCSKAFLWAYFIYACET VIVLVVARERINKFISTSDKRFDEVIYNIIFMSIMVPHFLLPVASWRNGSEVAKFKNMWT DFQYKYLIVTGKPIVFPKLYPITWTLCIVSWSLSLVIILSQYYLQPDFQFCHTFAYYHII AMLNGFCSLWFVNCTAFGTASKAFAKELTDVLATERPAAKLTEYRHLWVDLSHMMQQLGK AYSNMYGIYCLVIFFTTIIATYGSLSEIIEHGATYKEVGLFVIVFYCMSLLFIICNEAHH ASKRVGLNFQERLLNVNLTAVDKATQKEVEMFLVAIDKNPPTMNLDGYANINRGLITSNI SFMATYLVVLMQFKLTLLRQSAKNAFISALKANLSRIRSLDADKVNT |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | GPRgr22 |
Synonyms | GPRgr22; AGAP009999; Gustatory and odorant receptor 22 |
UniProt ID | Q7PMG3 |
◆ Recombinant Proteins | ||
Arl4a-3215M | Recombinant Mouse Arl4a, His-tagged | +Inquiry |
ACAA2-7576H | Recombinant Human ACAA2, His-tagged | +Inquiry |
BMP2-26315TH | Recombinant Human BMP2 | +Inquiry |
RFL35084SF | Recombinant Full Length Saccharomyces Cerevisiae Uncharacterized Protein Scy_1535 (Scy_1535) Protein, His-Tagged | +Inquiry |
SMIM18-5663C | Recombinant Chicken SMIM18 | +Inquiry |
◆ Native Proteins | ||
S100a6-43M | Native Mouse S100A6 | +Inquiry |
C1q-07R | Native Rat C1q Protein | +Inquiry |
SUOX-248G | Active Native Chicken Sulfite Oxidase | +Inquiry |
Fixa-278B | Active Native Bovine Factor Ixa | +Inquiry |
CAPN2-22P | Active Native Porcine CAPN2 protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
MSRB1-1951HCL | Recombinant Human SEPX1 293 Cell Lysate | +Inquiry |
C3orf67-8039HCL | Recombinant Human C3orf67 293 Cell Lysate | +Inquiry |
Pons-396H | Human Pons (Alzheimers Disease) Lysate | +Inquiry |
MAGEB2-4545HCL | Recombinant Human MAGEB2 293 Cell Lysate | +Inquiry |
GSDMD-5725HCL | Recombinant Human GSDMD 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GPRgr22 Products
Required fields are marked with *
My Review for All GPRgr22 Products
Required fields are marked with *
0
Inquiry Basket