Recombinant Full Length Anguilla Anguilla Rhodopsin, Deep-Sea Form Protein, His-Tagged
Cat.No. : | RFL11524AF |
Product Overview : | Recombinant Full Length Anguilla anguilla Rhodopsin, deep-sea form Protein (Q90214) (1-352aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Anguilla anguilla |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-352) |
Form : | Lyophilized powder |
AA Sequence : | MNGTEGPNFYIPMSNITGVVRSPFEYPQYYLAEPWAYTILAAYMFTLILLGFPVNFLTLY VTIEHKKLRTPLNYILLNLAVANLFMVFGGFTTTVYTSMHGYFVFGETGCNLEGYFATLG GEISLWSLVVLAIERWVVVCKPMSNFRFGENHAIMGLAFTWIMANSCAMPPLFGWSRYIP EGMQCSCGVDYYTLKPEVNNESFVIYMFIVHFSVPLTIISFCYGRLVCTVKEAAAQQQES ETTQRAEREVTRMVVIMVIAFLVCWVPYASVAWYIFTHQGSTFGPVFMTVPSFFAKSSAI YNPLIYICLNSQFRNCMITTLFCGKNPFQEEEGASTTASKTEASSVSSVSPA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Anguilla anguilla Rhodopsin, deep-sea form |
Synonyms | Rhodopsin, deep-sea form |
UniProt ID | Q90214 |
◆ Recombinant Proteins | ||
KLRF1-5672H | Active Recombinant Human Killer Cell Lectin-Like Receptor Subfamily F, Member 1, Fc-tagged | +Inquiry |
HBP-3798P | Recombinant Pig HBP, His-tagged | +Inquiry |
ALPK1-001H | Recombinant Human ALPK1 Protein, Myc/DDK-tagged | +Inquiry |
RFL4465SF | Recombinant Full Length Staphylococcus Aureus Lipoprotein Signal Peptidase(Lspa) Protein, His-Tagged | +Inquiry |
CPLX3A-7663Z | Recombinant Zebrafish CPLX3A | +Inquiry |
◆ Native Proteins | ||
VTN-31736TH | Native Human VTN | +Inquiry |
FGG-53S | Native Sheep Fibrinogen | +Inquiry |
F10-5395R | Active Native Rat Coagulation Factor X | +Inquiry |
ctxB-01V | Native Vibrio cholerae ctxB Protein | +Inquiry |
CP-8074M | Native Mouse Serum Ceruloplasmin | +Inquiry |
◆ Cell & Tissue Lysates | ||
ZFP90-1978HCL | Recombinant Human ZFP90 cell lysate | +Inquiry |
GIMAP4-5938HCL | Recombinant Human GIMAP4 293 Cell Lysate | +Inquiry |
ZNF213-120HCL | Recombinant Human ZNF213 293 Cell Lysate | +Inquiry |
HeLa-041HCL | Human Trichostatin A Stimulated HeLa Whole Cell Lysate | +Inquiry |
ADPRHL1-9002HCL | Recombinant Human ADPRHL1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Anguilla anguilla Rhodopsin, deep-sea form Products
Required fields are marked with *
My Review for All Anguilla anguilla Rhodopsin, deep-sea form Products
Required fields are marked with *
0
Inquiry Basket