Recombinant Full Length Amia Calva Cytochrome C Oxidase Subunit 1(Mt-Co1) Protein, His-Tagged
Cat.No. : | RFL16016AF |
Product Overview : | Recombinant Full Length Amia calva Cytochrome c oxidase subunit 1(mt-co1) Protein (P29643) (1-188aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Amia calva (Bowfin) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-188) |
Form : | Lyophilized powder |
AA Sequence : | QHLFWFFGHPEVYILILPGFGMVSHIVAYYAGKKEPFGYMGMVWAMMAIGLLGFIVWAHH MFTVGMDVDTRAYFTSATMVIAIPTGVKVFSWLATLHGGAIKWETPLLWALGFIFLFTVG GLTGIVLANSSLDIVLHDTYYVVAHFHYVLSMGAVFAIMGGFVHWFPLFSGYTLHPTWSK IHFGVMFV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | mt-co1 |
Synonyms | mt-co1; coi; coxi; mtco1; Cytochrome c oxidase subunit 1; Cytochrome c oxidase polypeptide I; Fragment |
UniProt ID | P29643 |
◆ Native Proteins | ||
AFP-3018P | Native pig AFP | +Inquiry |
Bcl2a1b-5322M | Native Mouse B-Cell Leukemia/Lymphoma 2 Related Protein A1b | +Inquiry |
Lectin-1850U | Active Native Ulex Europaeus Agglutinin I Protein, Biotinylated | +Inquiry |
Lectin-1771D | Active Native Dolichos Biflorus Lectin Protein | +Inquiry |
Bone Marrow-007H | Human Bone Marrow Lysate, Total Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
WWP2-001HCL | Recombinant Human WWP2 cell lysate | +Inquiry |
SkeletalMuscles-571M | MiniPig Skeletal Muscles Lysate, Total Protein | +Inquiry |
CIAPIN1-7500HCL | Recombinant Human CIAPIN1 293 Cell Lysate | +Inquiry |
MSL3-4112HCL | Recombinant Human MSL3 293 Cell Lysate | +Inquiry |
GPS1-5766HCL | Recombinant Human GPS1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All mt-co1 Products
Required fields are marked with *
My Review for All mt-co1 Products
Required fields are marked with *
0
Inquiry Basket