Recombinant Full Length Allomyces Arbuscula Atp Synthase Subunit A(Atp6) Protein, His-Tagged
Cat.No. : | RFL17097AF |
Product Overview : | Recombinant Full Length Allomyces arbuscula ATP synthase subunit a(ATP6) Protein (P50363) (1-262aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Allomyces arbusculus (Aquatic fungus) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-262) |
Form : | Lyophilized powder |
AA Sequence : | MFINLNPLEQFSVYSATSAILGSSSNSLAITSLTNIAILFIIGLLVLTIFQISASSHLIK PTRWNIVLETWVASILGIVKDQIGNDAKNSLIYFPLIFTFFSFVFISNILGMIPYSFTPT SHISVTLGLSIAIMIGVTLIGFSKHQLDFFSLFVPKGTPLALVPLLVLIEFISYSARAFS LALRLTANVSAGHCLFGVISMLSVSACMAVSSILLKGITIGLPLAVLVVLYGLELLVALL QSYVFTLLTCSYLADIVNMGDH |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ATP6 |
Synonyms | ATP6; ATP synthase subunit a; F-ATPase protein 6 |
UniProt ID | P50363 |
◆ Recombinant Proteins | ||
SAOUHSC-02331-4645S | Recombinant Staphylococcus aureus subsp. aureus NCTC 8325 SAOUHSC_02331 protein, His-tagged | +Inquiry |
STK24-1155H | Recombinant Human STK24 Protein (M1-H443), GST tagged | +Inquiry |
EVI5L-3549H | Recombinant Human EVI5L Protein, GST-tagged | +Inquiry |
KRAS-08H | Recombinant Human KRAS Q61H Protein, AviTag™, Biotinylated | +Inquiry |
SARS-1-06PsV | SARS-1 Coronavirus Pseudoviral Particles | +Inquiry |
◆ Native Proteins | ||
GOT-186S | Active Native Porcine Glutamate Oxaloacetate Tranasminase | +Inquiry |
Annexin-V-009H | Native Human Annexin-V Protein | +Inquiry |
GOT1-5353P | Active Native Porcine GOT1 protein | +Inquiry |
ACE-3047R | Native rabbit ACE | +Inquiry |
20S Immunoproteasome-224C | Active Native Cynomolgus monkey 20S Immunoproteasome protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
ZC3H3-746HCL | Recombinant Human ZC3H3 lysate | +Inquiry |
MGAT1-4343HCL | Recombinant Human MGAT1 293 Cell Lysate | +Inquiry |
ZNF547-55HCL | Recombinant Human ZNF547 293 Cell Lysate | +Inquiry |
VPS25-395HCL | Recombinant Human VPS25 293 Cell Lysate | +Inquiry |
TP53I13-858HCL | Recombinant Human TP53I13 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ATP6 Products
Required fields are marked with *
My Review for All ATP6 Products
Required fields are marked with *
0
Inquiry Basket