Recombinant Full Length Alcelaphine Herpesvirus 1 Uncharacterized Gene A8 Protein(A8) Protein, His-Tagged
Cat.No. : | RFL8103AF |
Product Overview : | Recombinant Full Length Alcelaphine herpesvirus 1 Uncharacterized gene A8 protein(A8) Protein (O36401) (1-683aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Alcelaphine herpesvirus 1 |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-683) |
Form : | Lyophilized powder |
AA Sequence : | MDNYTLALNCNHTTHGYAHYVYSTLSYLVFIGNAPGYPNCENCIYDITFNSTSMLNISNN YFHIANATLGAPEYPEQPVTLSVIGEESPWVAWLAVHTPDKNYTEDANTARAVMRVLDPF NISWCAVYNVQSVDPTDTQDISNCTEVSEELPVNNQKSSIHLNTYFLNSTFTVSVSLNAS NISSQCSGNVSLENMTSNVHIPCPTLPLTVSVKASTDNMQTGAAVNASIDIGWLLQNLTD ASLTVSSSPGNLTQKNCTTYKNISKTDRHVRDENLYVLAQIPALEGHKDSFTLTRSPILL NFSRNSSEFQLVLYDRNSSCVWANPANGTDTILVSMSCPHITATISPRGEIKVNVTGNFS RNANLSLAFLSSKGKEYAGVLLQAFEPSTRPPPGTVAPGILSTTANFETSTNKSSPTYTP TPAKLSTPPGLTNTLLLTAGEHNSGIGSTLEPLTTVSVQVLQTPSSPTRDTSTLVIKLTT VPQDHKTVSPSLVTPGRTSTLPIVSMTHFSREGSSPKPQTTAAKTSSEASLPPLLTTTPT PTNTEKSQSTFASSTVSVDTTFTGDDVNTVGTMSPSITQTLPITPTSGRQYIVVGCCTLN RRSGNLFFFFLFVAAHRESGHNTSMPNPHHNSVKPEDHPHHPEGDHPDADHHERFQIWLL PIAGTIFALVALVIVNIALRMTE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | A8 |
Synonyms | A8; Uncharacterized gene A8 protein |
UniProt ID | O36401 |
◆ Recombinant Proteins | ||
AHNAK-4827H | Recombinant Human AHNAK Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
N-888S | Recombinant SARS-CoV N Protein, His-tagged | +Inquiry |
CXCL13-1169C | Recombinant Cynomolgus CXCL13 protein, His-tagged | +Inquiry |
PPP6C-3597C | Recombinant Chicken PPP6C | +Inquiry |
gG1-071H | Recombinant HSV-1 glycoprotein G Antigen, His&TrxA tagged | +Inquiry |
◆ Native Proteins | ||
TSHB-704H | Native Human Thyroid Stimulating Hormone, Beta | +Inquiry |
CP-8075R | Native Rat Serum Ceruloplasmin | +Inquiry |
COL4A1-001H | Native Human COL4A1 Protein | +Inquiry |
ALB-315B | Native Bovine ALB protein | +Inquiry |
AHSG-1001H | Human Leucine-rich Alpha-2-glycoprotein 1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
SmallIntestine-497C | Chicken Small Intestine Lysate, Total Protein | +Inquiry |
UBQLNL-544HCL | Recombinant Human UBQLNL 293 Cell Lysate | +Inquiry |
SALL2-1557HCL | Recombinant Human SALL2 cell lysate | +Inquiry |
CAND1-7869HCL | Recombinant Human CAND1 293 Cell Lysate | +Inquiry |
ADAM8-855CCL | Recombinant Cynomolgus ADAM8 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All A8 Products
Required fields are marked with *
My Review for All A8 Products
Required fields are marked with *
0
Inquiry Basket