Recombinant Full Length Ajellomyces Dermatitidis Probable Endonuclease Lcl3(Lcl3) Protein, His-Tagged
Cat.No. : | RFL28226AF |
Product Overview : | Recombinant Full Length Ajellomyces dermatitidis Probable endonuclease LCL3(LCL3) Protein (C5GB89) (1-303aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Ajellomyces dermatitidis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-303) |
Form : | Lyophilized powder |
AA Sequence : | MPWLFWSSGSQRQMSSNENNTDKTTPIVGETNSSSSSTQCANCSTPITTPPTDTSNQVNP PHQTHRPPALDWNASLATRDWAGDFKDPRNLIPTLLLTSGILFCVRIHRKYLRRIPVATS ISPTYFHKRSIFGRVTSVGDGDNFRLFHTPGGRLAGWEWLPFRKVPTAKKELKDRTIHIR LAGVDAPELPHFGRPAQPYSDAAHTWLTTYLLNRRVRAYVYRQDQYGRVVATVYVRRWPF PFIRRDVGLQMLRAGLAPVNEAKTGVDFGGEGTGRRLPPRGGKGEEPPEGDLEGEGGFRG GES |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | LCL3 |
Synonyms | LCL3; BDCG_01496; Probable endonuclease LCL3 |
UniProt ID | C5GB89 |
◆ Recombinant Proteins | ||
SSP-RS03745-0445S | Recombinant Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305 SSP_RS03745 protein, His-tagged | +Inquiry |
CDK4-758HAF488 | Recombinant Human CDK4 Protein, GST-tagged, Alexa Fluor 488 conjugated | +Inquiry |
CPEB3-7628Z | Recombinant Zebrafish CPEB3 | +Inquiry |
OGN-2223Z | Recombinant Zebrafish OGN | +Inquiry |
HDX-4666H | Recombinant Human HDX Protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
ALP-8330C | Native Calf ALP | +Inquiry |
Complement C5a-54H | Native Human Complement C5a | +Inquiry |
GPT-189P | Active Native Porcine Glutamate Pyruvate Transaminase (GPT), Alanine Transaminase (ALT) | +Inquiry |
CRP-158R | Native Rabbit C-Reactive Protein | +Inquiry |
Fibrinogen-71R | Active Native Rabbit Fibrinogen | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL22RA1-768CCL | Recombinant Canine IL22RA1 cell lysate | +Inquiry |
CHRM1-7521HCL | Recombinant Human CHRM1 293 Cell Lysate | +Inquiry |
SAR1A-2065HCL | Recombinant Human SAR1A 293 Cell Lysate | +Inquiry |
Artery-25H | Human Artery Membrane Lupus Lysate | +Inquiry |
SFXN3-1893HCL | Recombinant Human SFXN3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All LCL3 Products
Required fields are marked with *
My Review for All LCL3 Products
Required fields are marked with *
0
Inquiry Basket