Recombinant Full Length Uncinocarpus Reesii Probable Endonuclease Lcl3(Lcl3) Protein, His-Tagged
Cat.No. : | RFL25221UF |
Product Overview : | Recombinant Full Length Uncinocarpus reesii Probable endonuclease LCL3(LCL3) Protein (C4JVW2) (1-303aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Uncinocarpus reesii |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-303) |
Form : | Lyophilized powder |
AA Sequence : | MRWLFWASPPQNDSHDASPNAHPRPIKPQRREAHQDHTPAPGQAAPEPTISNAQSSRDWN SSLNATDWKQFTEPKTIIPTALLTGGILLCVHIHRKYLRRIPEAGYISPSYFRRRSLLGK VTSVGDGDNFRLYHTPGGRLGGWEWLRKVPTGKNELRNRTIHIRLAGIDAPELPHFGRPA QPYSHEAHTWLTNYLLNRRVRAFLYRPDQYGRVVATVYVRRWLLFKQDVGLQMLKQGWAT VYEAKTGVEFGGAELERKYRDAEAWAKRRGLGLWEGLKGKKKEKWESPREFKTRMAAEEA QRK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | LCL3 |
Synonyms | LCL3; UREG_06704; Probable endonuclease LCL3 |
UniProt ID | C4JVW2 |
◆ Native Proteins | ||
F9-26523H | Active Native Human F9 Protein | +Inquiry |
TF-31156TH | Native Human TF | +Inquiry |
IgA-242D | Native Dog Immunoglobulin A | +Inquiry |
Apotransferrin-37D | Native dog Apotransferrin | +Inquiry |
ASO-153H | Active Native Human Antistreptolysin O | +Inquiry |
◆ Cell & Tissue Lysates | ||
HNRNPF-5447HCL | Recombinant Human HNRNPF 293 Cell Lysate | +Inquiry |
RPRD1B-1037HCL | Recombinant Human RPRD1B cell lysate | +Inquiry |
IL1R1-1935RCL | Recombinant Rat IL1R1 cell lysate | +Inquiry |
TMEM135-1003HCL | Recombinant Human TMEM135 293 Cell Lysate | +Inquiry |
KRTAP10-1-4858HCL | Recombinant Human KRTAP10 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All LCL3 Products
Required fields are marked with *
My Review for All LCL3 Products
Required fields are marked with *
0
Inquiry Basket