Recombinant Full Length Agrobacterium Tumefaciens Protein Virb10(Virb10) Protein, His-Tagged
Cat.No. : | RFL18074AF |
Product Overview : | Recombinant Full Length Agrobacterium tumefaciens Protein virB10(virB10) Protein (P05359) (1-377aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Agrobacterium Tumefaciens |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-377) |
Form : | Lyophilized powder |
AA Sequence : | MNNDSQQAAHEVDASGSLVSDKHRRRLSGSQKLIVGGVVLALSLSLIWLGGRQKKVNDNA SPSTLIAANTKPFHPAPIEVPPDTPAVQEAVQPTVPQPPRGEPERHEPRPEETPIFAYSS GDQGVSKRASQGDMGRRQEDKRDDNSLPNGEVSGENDLSIRMKPTELQPSRATLLPHPDF MVTQGTIIPCILQTAIDTNLAGYVKCVLPQDIRGTTNNIVLLDRGTTVVGEIQRGLQQGD ERVFVLWDRAETPDHAMISLTSPSADELGRPGLPGSVDSHFWQRFSGAMLLSAVQGAFQA ASTYAGSSGGGMSFNSFQNNGEQTTETALKATINIPPTLKKNQGDTVSIFVARDLDFFGV YQLRLTGGAARGRNRRS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | virB10 |
Synonyms | virB10; Protein virB10 |
UniProt ID | P05359 |
◆ Recombinant Proteins | ||
TNFSF13B-377H | Active Recombinant Human TNFSF13B Protein, His & Avi-tagged, Biotinylated | +Inquiry |
TRAB-1929S | Recombinant Staphylococcus aureus (strain: PM64, other: HA-MRSA) TRAB protein, His-tagged | +Inquiry |
DHRS4L2-2600H | Recombinant Human DHRS4L2 Protein, GST-tagged | +Inquiry |
DNAJB1-271H | Recombinant Human DNAJB1 protein, His/MBP-tagged | +Inquiry |
SUB1-30794TH | Recombinant Human SUB1, His-tagged | +Inquiry |
◆ Native Proteins | ||
Artery-015H | Human Artery Lysate, Total Protein | +Inquiry |
CALMODULIN-185B | Active Native Bovine Calmodulin | +Inquiry |
IgG-008G | Native Guinea Pig Whole Molecule IgG, Biotin Conjugated | +Inquiry |
PMSG-01M | Native Pregnant Mare Serum Gonadotropin, Tag Free | +Inquiry |
HSV1Ag-354H | Active Native Herpes Simplex Virus 1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CEACAM1-2214MCL | Recombinant Mouse CEACAM1 cell lysate | +Inquiry |
COQ4-385HCL | Recombinant Human COQ4 cell lysate | +Inquiry |
FBXL8-602HCL | Recombinant Human FBXL8 cell lysate | +Inquiry |
ANXA8-1023HCL | Recombinant Human ANXA8 cell lysate | +Inquiry |
SLC29A2-1742HCL | Recombinant Human SLC29A2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All virB10 Products
Required fields are marked with *
My Review for All virB10 Products
Required fields are marked with *
0
Inquiry Basket