Recombinant Full Length African Swine Fever Virus Uncharacterized Membrane Protein Kp93L (Pret-001) Protein, His-Tagged
Cat.No. : | RFL22660AF |
Product Overview : | Recombinant Full Length African swine fever virus Uncharacterized membrane protein KP93L (Pret-001) Protein (P0CAL8) (1-74aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | African swine fever virus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-74) |
Form : | Lyophilized powder |
AA Sequence : | MFFLGFLSVTMDYWSTKVKIYSYTLLTLLVITLICYLIHIFCKLRMKKNSVTNNMPPPPP PYTVSSRCSQYYID |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Pret-001 |
Synonyms | Pret-001; Uncharacterized membrane protein KP93L |
UniProt ID | P0CAL8 |
◆ Native Proteins | ||
HBsAg-ad-21H | Native Human HBsAg protein (Subtype ad) | +Inquiry |
F2-277B | Active Native Bovine α-Thrombin-BFPRck (Biotin) | +Inquiry |
PLAU-31687TH | Native Human PLAU | +Inquiry |
GOT1-5351H | Native Human Glutamic-Oxaloacetic Transaminase 1, Soluble (aspartate aminotransferase 1) | +Inquiry |
Collagen-59C | Native Chicken Collagen Type II | +Inquiry |
◆ Cell & Tissue Lysates | ||
SLC25A24-1624HCL | Recombinant Human SLC25A24 cell lysate | +Inquiry |
ATP1A2-8612HCL | Recombinant Human ATP1A2 293 Cell Lysate | +Inquiry |
VWC2-2150HCL | Recombinant Human VWC2 cell lysate | +Inquiry |
Spleen-076MCL | Adult Mouse Spleen Whole Cell Lysate | +Inquiry |
ZNF32-2009HCL | Recombinant Human ZNF32 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Pret-001 Products
Required fields are marked with *
My Review for All Pret-001 Products
Required fields are marked with *
0
Inquiry Basket