Source :	E. coli
Species :	Human
Tag :	His
Protein length :	C-324aa
AA sequence :	CGHCKALAPTWEQLALGLEHSETVKIGKVDCTQHYELCSGNQVRGYPTLLWFRDGKKVDQYKGKRDLESLREYVESQLQRTETGATETVTPSEAPVLAAEPEADKGTVLALTENNFDDTIAEGITFIKFYAPWCGHCKTLAPTWEELSKKEFPGLAGVKIAEVDCTAERNICSKYSVRGYPTLLLFRGGKKVSEHSGGRDLDSLHRFVLSQAKDEL
Storage :	Aliquot and store at -20 centigrade to -80 centigrade for up to 6 months. Avoid freeze thaw cycles.
Storage buffer :	1M PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7. )

Gene Name	TXNDC5 thioredoxin domain containing 5 [ Homo sapiens (human) ]
Official Symbol	TXNDC5
Synonyms	TXNDC5; thioredoxin domain containing 5 (endoplasmic reticulum); thioredoxin domain containing 5; thioredoxin domain-containing protein 5; EndoPDI; ERp46; FLJ21353; FLJ90810; Hcc 2; MGC3178; PDIA15; protein disulfide isomerase family A; member 15; ER protein 46; thioredoxin related protein; thioredoxin-like protein p46; endoplasmic reticulum protein ERp46; endothelial protein disulphide isomerase; endoplasmic reticulum resident protein 46; protein disulfide isomerase family A, member 15; ERP46; HCC-2; STRF8; UNQ364; ENDOPDI; FLJ21789
Gene ID	81567
mRNA Refseq	NM_030810.4
Protein Refseq	NP_110437
MIM	616412
UniProt ID	Q8NBS9

ACE2-735H	Recombinant Human ACE2 Protein, His-tagged	+Inquiry
FGF10-15H	Active Recombinant Human FGF10 protein	+Inquiry
KITLG-19H	Active Recombinant Human KITLG Protein, Pre-aliquoted	+Inquiry
DEFB1-17H	Active Recombinant Human DEFB1 protein(1-47aa)	+Inquiry
DEFB4-18H	Active Recombinant Human DEFB4 protein(1-50aa)	+Inquiry