Recombinant Full Length African Swine Fever Virus Major Structural Protein P17(Ba71V-107) Protein, His-Tagged
Cat.No. : | RFL4630AF |
Product Overview : | Recombinant Full Length African swine fever virus Major structural protein p17(Ba71V-107) Protein (Q89424) (1-117aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | African swine fever virus |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-117aa) |
Form : | Lyophilized powder |
AA Sequence : | MDTETSPLLSHNLSTREGIKQSTQGLLAHTIARYPGTTAILLGILILLVIILIIVAIVYYNRSVDCKSSMPKPPPSYYVQQPEPHHHFPVFFRKRKNSTSLQSHIPSDEQLAELAHS Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request. |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Ba71V-107 |
Synonyms | Ba71V-107; D117L; Major structural protein p17 |
UniProt ID | Q89424 |
◆ Recombinant Proteins | ||
RFL4630AF | Recombinant Full Length African Swine Fever Virus Major Structural Protein P17(Ba71V-107) Protein, His-Tagged | +Inquiry |
Ba71V-107-2443A | Recombinant ASFV Ba71V-107 Full Length Transmembrane protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Ba71V-107 Products
Required fields are marked with *
My Review for All Ba71V-107 Products
Required fields are marked with *
0
Inquiry Basket