Recombinant Full Length African Swine Fever Virus Envelope Protein P54(Mal-134) Protein, His-Tagged
Cat.No. : | RFL21834AF |
Product Overview : | Recombinant Full Length African swine fever virus Envelope protein p54(Mal-134) Protein (Q89784) (1-176aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | African swine fever virus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-176) |
Form : | Lyophilized powder |
AA Sequence : | MDSEFFQPVYPRHYGECLSSTPAPSFFSTHMYTILIAIVVLIIIIIVLIYLFSSRKKKAA AAIEEEDIQFINPYQDQQWAGVTPQPGIAKPAGASTGSAGKPVMGRPVTNKPVTNKPVTD RLGMAAGGPAAASAPAHPAELYTTATTQNTASQTMPADENLRQRNTYTHKDLENSL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Mal-134 |
Synonyms | Mal-134; j13L; Envelope protein p54 |
UniProt ID | Q89784 |
◆ Native Proteins | ||
COD-39 | Active Native Choline oxidase | +Inquiry |
Lectin-1800L | Active Native Lycopersicon Esculentum Lectin Protein, Agarose bound | +Inquiry |
ADPGK-45 | Active Native ADP-specific glucokinase | +Inquiry |
IgG-218D | Native Dog Immunoglobulin G | +Inquiry |
CP-8073H | Native Human Plasma Ceruloplasmin | +Inquiry |
◆ Cell & Tissue Lysates | ||
PSMB9-2766HCL | Recombinant Human PSMB9 293 Cell Lysate | +Inquiry |
ANXA7-8826HCL | Recombinant Human ANXA7 293 Cell Lysate | +Inquiry |
MPZL3-4216HCL | Recombinant Human MPZL3 293 Cell Lysate | +Inquiry |
CELF4-183HCL | Recombinant Human CELF4 cell lysate | +Inquiry |
ARL2BP-8715HCL | Recombinant Human ARL2BP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Mal-134 Products
Required fields are marked with *
My Review for All Mal-134 Products
Required fields are marked with *
0
Inquiry Basket