Recombinant Full Length African Swine Fever Virus Envelope Protein P54 (Ken-138) Protein, His-Tagged
Cat.No. : | RFL13080AF |
Product Overview : | Recombinant Full Length African swine fever virus Envelope protein p54 (Ken-138) Protein (P0C9Z8) (1-175aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | African swine fever virus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-175) |
Form : | Lyophilized powder |
AA Sequence : | MDSEFFQPVYPRHYGECLSPTSTPSFFSTHMCTILVAIVVLIIIIIVLIYLFSSRKKKAA APAIEEEDIQFINPYQDQQWAGATPQPGTSKPAGATTGNVGKPITDRPATDRPVTNNPVT DRLIMATGGPAAASAPSAELYTTATTQNTASQTMPAVEALRQRSTYTHKDLENSL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Ken-138 |
Synonyms | Ken-138; Envelope protein p54 |
UniProt ID | P0C9Z8 |
◆ Native Proteins | ||
IgA-7431M | Native Mouse Immunoglobulin A | +Inquiry |
ALB-315B | Native Bovine ALB protein | +Inquiry |
ALPP-8347H | Native Human ALPP | +Inquiry |
Clostripain-01C | Native Clostridium histolyticum Clostripain | +Inquiry |
ORM1-8017R | Native Rat Serum Alpha-1-Acid GlycoProtein | +Inquiry |
◆ Cell & Tissue Lysates | ||
USP54-729HCL | Recombinant Human USP54 lysate | +Inquiry |
MPST-4224HCL | Recombinant Human MPST 293 Cell Lysate | +Inquiry |
TEX13A-1141HCL | Recombinant Human TEX13A 293 Cell Lysate | +Inquiry |
IL17RD-2919HCL | Recombinant Human IL17RD cell lysate | +Inquiry |
SLC5A2-1709HCL | Recombinant Human SLC5A2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Ken-138 Products
Required fields are marked with *
My Review for All Ken-138 Products
Required fields are marked with *
0
Inquiry Basket