Recombinant Full Length Aeromonas Hydrophila Subsp. Hydrophila Macrolide Export Atp-Binding/Permease Protein Macb 1(Macb1) Protein, His-Tagged
Cat.No. : | RFL8509AF |
Product Overview : | Recombinant Full Length Aeromonas hydrophila subsp. hydrophila Macrolide export ATP-binding/permease protein MacB 1(macB1) Protein (A0KGB3) (1-648aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Aeromonas Hydrophila |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-648) |
Form : | Lyophilized powder |
AA Sequence : | MREPLLQLSGIRRHFGDGERRVEVLKGIDLTIARGEMVAIVGASGSGKSTLLNILGCLDQ PSEGSYRVAGRETSRLTADALATLRREHFGFIFQRYHLLGDLSARDNVALPALYAGLAGD ARKARAERLLQRLGLGSRLDYKPSQLSGGQQQRVSIARALINGGQVILADEPTGALDSQS GAEVLGILGALHRQGHTLVLVTHDMAIAEQAERIIELKDGAVVADRRREPTPPSPAPTTS RADTGGRGGLAGRLGAAFKMALLAMRAQRMRTFLTMLGIIIGIAAVVSVVALGRGSQQQV LANINAMGTSTLEIFPGSGFGDRRAEAVQTLRVEDAEALAGLGYVHSVTPSLATSVTLRR GSQAVLGSVNGVGEQFFQVRGYRLLQGMLFDAASVTALAQEVVIDENSLARLFGAGESPL GQVILLGSLPCRVIGVVARNQSGFGSDENLNVWIPHTTAMTRMLGQSHLRSISVRVQDEV ALAAAEDGISRLLRERHGAQDFFVLNTDSIRQAITSTNATLTLLIAMIALISLVVGGIGV MNIMLVSVSERTREIGVRMAVGARTGDILQQFLIEAVLVCLLGGAAGVLLSLLIGVLFEH FSSQFTLSYSLDAVLMAFFCSSLIGVLFGFFPARRAARMDPIHALERE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | macB1 |
Synonyms | macB1; AHA_0761; Macrolide export ATP-binding/permease protein MacB 1 |
UniProt ID | A0KGB3 |
◆ Recombinant Proteins | ||
NPAT-10806M | Recombinant Mouse NPAT Protein | +Inquiry |
PLEKHO2-3471R | Recombinant Rhesus monkey PLEKHO2 Protein, His-tagged | +Inquiry |
FABP9-5429M | Recombinant Mouse FABP9 Protein | +Inquiry |
KDR-0821H | Active Recombinant Human KDR protein, Fc-tagged | +Inquiry |
MPXV-0559 | Recombinant Monkeypox Virus H3L Protein, MPXVgp093 | +Inquiry |
◆ Native Proteins | ||
Lectin-1722C | Native Canavalia ensiformis Lectin, Biotin conjugated | +Inquiry |
Cp-674M | Native Mouse Ceruloplasmin | +Inquiry |
F10-5395R | Active Native Rat Coagulation Factor X | +Inquiry |
KRT19-40H | Native Human KRT19 protein | +Inquiry |
Deoxycholate-03T | Native Toxoplasma Gondii Deoxycholate Lysate, RH strain | +Inquiry |
◆ Cell & Tissue Lysates | ||
Adipose-630B | Bovine Adipose Tissue Lysate, Total Protein | +Inquiry |
GSS-5720HCL | Recombinant Human GSS 293 Cell Lysate | +Inquiry |
ZMYND12-150HCL | Recombinant Human ZMYND12 293 Cell Lysate | +Inquiry |
EFNA1-1514RCL | Recombinant Rat EFNA1 cell lysate | +Inquiry |
SW1353-20HL | Human SW1353 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All macB1 Products
Required fields are marked with *
My Review for All macB1 Products
Required fields are marked with *
0
Inquiry Basket