Recombinant Full Length Aedes Aegypti Kynurenine 3-Monooxygenase(Kh) Protein, His-Tagged
Cat.No. : | RFL36186AF |
Product Overview : | Recombinant Full Length Aedes aegypti Kynurenine 3-monooxygenase(kh) Protein (Q86PM2) (1-476aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Aedes Aegypti |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-476) |
Form : | Lyophilized powder |
AA Sequence : | MTAQYKQTNTNGLTARNLNVAVVGGGLVGSLFALHLGKKGHTVDLYEYREDIRTAELVIG RSINLALSARGRKALAEVGLEDALLQHGIPMKGRMLHDLKGNRKIVPYDANTNQCIYSVG RKHLNEVLLDAAEKYPNIHLYFNKKLQSANLDEGEMSFIDPTTKESTHTKADLIVGCDGA YSAVRKEIVKRPGYDYSQTYIEHGYLELCIPPTKDGDFAMPHNYLHIWPRGKFMMIALPN QDRTWTVTLFMPFTNFNSIKCDGDLLKFFRTYFPDAIDLIGRERLVKDFFKTRPQSLVMI KCKPYNVGGKAVIIGDAAHAMVPFYGQGMNAGFEDCTVLTELFNQHGSDVDRILAEFSDT RWEDAHSICDLAMYNYVEMRDLVTKRSYLFRKKLDELLYWMLPNTWVPLYNSVSFSHMRY SKCIANRKWQDKILTRVLYCCSITAVAAAGYFGYKYGNMDLVQHYSSSVLQLLKLK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | kh |
Synonyms | kh; AAEL008879; Kynurenine 3-monooxygenase; Kynurenine 3-hydroxylase |
UniProt ID | Q86PM2 |
◆ Native Proteins | ||
F2-274B | Active Native Bovine α-Thrombin | +Inquiry |
MMP2-8455M | Native Mouse MMP2 | +Inquiry |
Thrombin-20H | Active Native Pig Thrombin | +Inquiry |
Ighg2b-162M | Native Mouse Immunoglobulin G2b | +Inquiry |
Apotransferrin-38R | Native Rat Apotransferrin | +Inquiry |
◆ Cell & Tissue Lysates | ||
Stomach-Fundus-499R | Rhesus monkey Stomach-Fundus Lysate | +Inquiry |
TNFRSF18-1245RCL | Recombinant Rat TNFRSF18 cell lysate | +Inquiry |
Pine-705P | Pine Lysate, Total Protein | +Inquiry |
IKZF1-850HCL | Recombinant Human IKZF1 cell lysate | +Inquiry |
SF3B2-1917HCL | Recombinant Human SF3B2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All kh Products
Required fields are marked with *
My Review for All kh Products
Required fields are marked with *
0
Inquiry Basket