Recombinant Full Length Acorus Americanus Photosystem Ii Cp43 Chlorophyll Apoprotein(Psbc) Protein, His-Tagged
Cat.No. : | RFL2969AF |
Product Overview : | Recombinant Full Length Acorus americanus Photosystem II CP43 chlorophyll apoprotein(psbC) Protein (A9LYI1) (15-473aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Acorus americanus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (15-473) |
Form : | Lyophilized powder |
AA Sequence : | TLFNGTLALAGRDQETTGFAWWAGNARLINLSGKLLGAHVAHAGLIVFWAGAMNLFEVAH FVPEKPMYEQGLILLPHLATLGWGVGPGGEVIDTFPYFVSGVLHLISSAVLGFGGIYHAL LGPETLEESFPFFGYVWKDRNKMTTILGIHLILLGIGAFLLVFKALYFGGVYDTWAPGGG DVRKITNLTLSPSVIFGYLLKSPFGGEGWIVSVDDLEDIIGGHVWLGSICILGGIWHILT KPFAWARRAFVWSGEAYLSYSLGALAVFGFIACCFVWFNNTAYPSEFYGPTGPEASQAQA FTFLVRDQRLGANVGSAQGPTGLGKYLMRSPTGEVIFGGETMRFWDLRAPWLEPLRGPNG LDLSRLKKDIQPWQERRSAEYMTHAPLGSLNSVGGVATEINAVNYVSPRSWLATSHFVLG FFFFVGHLWHAGRARAAAAGFEKGIDRDLEPVLSMTPLN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | psbC |
Synonyms | psbC; Photosystem II CP43 reaction center protein; PSII 43 kDa protein; Protein CP-43 |
UniProt ID | A9LYI1 |
◆ Recombinant Proteins | ||
HAVCR2-0763M | Recombinant Mouse HAVCR2 protein, Fc-tagged | +Inquiry |
DNMT3L-931H | Active Recombinant Full Length Human DNMT3L Protein, N-6xHis-tagged | +Inquiry |
SPINT1A-12368Z | Recombinant Zebrafish SPINT1A | +Inquiry |
IGLON5-8083M | Recombinant Mouse IGLON5 Protein | +Inquiry |
LRRC1-2136Z | Recombinant Zebrafish LRRC1 | +Inquiry |
◆ Native Proteins | ||
BPI-182H | Native Human Bacterial/Permeability-Increasing Protein | +Inquiry |
SERPINC1-8032H | Native Human Plasma AntiThromblin III | +Inquiry |
COLV-19B | Native Bovine COLV Protein | +Inquiry |
FGF2-34B | Active Native Bovine bFGF | +Inquiry |
VLDL-392H | Native Human Very Low Density Lipoprotein | +Inquiry |
◆ Cell & Tissue Lysates | ||
Colon-82H | Human Colon Lupus Lysate | +Inquiry |
TBX3-1199HCL | Recombinant Human TBX3 293 Cell Lysate | +Inquiry |
INPP1-5200HCL | Recombinant Human INPP1 293 Cell Lysate | +Inquiry |
HSD17B2-5375HCL | Recombinant Human HSD17B2 293 Cell Lysate | +Inquiry |
S100A9-684HCL | Recombinant Human S100A9 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All psbC Products
Required fields are marked with *
My Review for All psbC Products
Required fields are marked with *
0
Inquiry Basket