Recombinant Full Length Acholeplasma Laidlawii Ribonuclease Y(Rny) Protein, His-Tagged
Cat.No. : | RFL14203AF |
Product Overview : | Recombinant Full Length Acholeplasma laidlawii Ribonuclease Y(rny) Protein (A9NGL9) (1-526aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Acholeplasma laidlawii |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-526) |
Form : | Lyophilized powder |
AA Sequence : | MFNVDTPALITFILLIVVGALGGALVGYFIRVAQHEKSLRLAREEAERIIEDGKKEADRT KREMVFEAKQEILTLRKEFDEDIKDRRQIVMNLEEKATQRENALNQRSQYLDKREIGLDA KEERHNERKEQLDIQYSKVEELIKEQEEKLSSISALSREQARELIMAQVRDSISNEIAAY IRDEEDNAKSIAQNKSKEILSLAMQKYAAETTSERTVTVVEIPNEDMKGRIIGKEGRNIR SLEALTGVDLIIDDTPEAVVLSGFDPVRREVAKRALTILVQDGRIHPGRIEEVVERARTE IDMFIREAGEEAVFKTGVGKVHPDIIKLLGRMTFRTSYGQNVLKHSIEVAFLAGKLAAEI GENEMLARRAGLFHDIGKAIDHEVEGSHVSIGVELMSRYKEPKEVIDAIASHHGDSEPES IIAVLVAAADALSAARPGARSESMDSYMKRLTQLEEISNDVTGVDKAYAIQAGREVRVMV LPDKVDDLGLINIARTIKEKIEAQMTYPGTIKVTVIREKRATDVAK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | rny |
Synonyms | rny; ACL_0886; Ribonuclease Y; RNase Y |
UniProt ID | A9NGL9 |
◆ Recombinant Proteins | ||
Ret-18M | Active Recombinant Mouse Ret/FC Chimera | +Inquiry |
SLC6A11-666H | Recombinant Human SLC6A11 Protein, GST-tagged | +Inquiry |
VTI1A-6207R | Recombinant Rat VTI1A Protein, His (Fc)-Avi-tagged | +Inquiry |
INSM2-5094H | Recombinant Human INSM2 Protein, GST-tagged | +Inquiry |
LILRA1-719H | Recombinant Human LILRA1 protein (Met1-Asn446), His-tagged | +Inquiry |
◆ Native Proteins | ||
S100B-257B | Native Bovine S-100b Protein | +Inquiry |
Fgb -68R | Native Rat Fibrinogen | +Inquiry |
Plg-32M | Native Mouse Plg protein | +Inquiry |
Factor Xa-64H | Native Human Factor Xa | +Inquiry |
KNG1-29338TH | Native Human KNG1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
MEF2A-4376HCL | Recombinant Human MEF2A 293 Cell Lysate | +Inquiry |
KIF14-925HCL | Recombinant Human KIF14 cell lysate | +Inquiry |
AFTPH-8985HCL | Recombinant Human AFTPH 293 Cell Lysate | +Inquiry |
ZFYVE20-175HCL | Recombinant Human ZFYVE20 293 Cell Lysate | +Inquiry |
PRKCDBP-2858HCL | Recombinant Human PRKCDBP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All rny Products
Required fields are marked with *
My Review for All rny Products
Required fields are marked with *
0
Inquiry Basket