Recombinant Full Length Acanthamoeba Polyphaga Mimivirus Uncharacterized Protein R694(Mimi_R694) Protein, His-Tagged
Cat.No. : | RFL25546AF |
Product Overview : | Recombinant Full Length Acanthamoeba polyphaga mimivirus Uncharacterized protein R694(MIMI_R694) Protein (Q5UNU8) (1-111aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | APMV |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-111) |
Form : | Lyophilized powder |
AA Sequence : | MSHFSRCFDECSKIERPNVNKKLTRLIIVLFCLLCIIVTLGVIGYKFLFKMSYVDAIYNT AITTSTLGIAPGDKTDAEKIFTGIYAVLVGVFFISVISAIVSYMFTTYILD |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | MIMI_R694 |
Synonyms | MIMI_R694; Uncharacterized protein R694 |
UniProt ID | Q5UNU8 |
◆ Native Proteins | ||
C3c-11H | Native Human C3c Protein | +Inquiry |
KLK3-8248H | Native Human Prostate Specific Antigen | +Inquiry |
MFGE8-289B | Native MFG-E8 | +Inquiry |
C3-001C | Active Native C. botulinum C3 Enzyme | +Inquiry |
CTSD-189H | Active Native Human Cathepsin D | +Inquiry |
◆ Cell & Tissue Lysates | ||
C21orf59-8098HCL | Recombinant Human C21orf59 293 Cell Lysate | +Inquiry |
SF268-011WCY | Human Glioblastoma SF268 Whole Cell Lysate | +Inquiry |
CLIP2-365HCL | Recombinant Human CLIP2 cell lysate | +Inquiry |
EPHB4-2128MCL | Recombinant Mouse EPHB4 cell lysate | +Inquiry |
CPT1C-7298HCL | Recombinant Human CPT1C 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MIMI_R694 Products
Required fields are marked with *
My Review for All MIMI_R694 Products
Required fields are marked with *
0
Inquiry Basket