Recombinant Full Length Acanthamoeba Polyphaga Mimivirus Uncharacterized Protein L310(Mimi_L310) Protein, His-Tagged
Cat.No. : | RFL30396AF |
Product Overview : | Recombinant Full Length Acanthamoeba polyphaga mimivirus Uncharacterized protein L310(MIMI_L310) Protein (Q5UPZ4) (1-164aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | APMV |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-164) |
Form : | Lyophilized powder |
AA Sequence : | MDITKHLKPNLVDPNIEESIIKKLKPPVEDYWAPTKSGLHKFYHNFIRPNIYLIIFIIIV LLLLYYRYRRVKADKEKEKLEDTDKEFDKSTNNDTNSKKIYHRQKNSKTLNSSKKQSIDD TELLLQLYNLNKENLREPPITKSNFAYPMYPYHKGGTLISPGSR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | MIMI_L310 |
Synonyms | MIMI_L310; Uncharacterized protein L310 |
UniProt ID | Q5UPZ4 |
◆ Recombinant Proteins | ||
ITGA5-4320H | Recombinant Human ITGA5 Protein (Met1-Tyr995), C-His tagged | +Inquiry |
MMADHC-3483H | Recombinant Human MMADHC Protein, His (Fc)-Avi-tagged | +Inquiry |
SERINC1-4990R | Recombinant Rat SERINC1 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL27584NF | Recombinant Full Length Neisseria Gonorrhoeae Undecaprenyl-Diphosphatase(Uppp) Protein, His-Tagged | +Inquiry |
FBXW5-5779M | Recombinant Mouse FBXW5 Protein | +Inquiry |
◆ Native Proteins | ||
Pectin-008A | Native Apple or Citrus fruits Pectin | +Inquiry |
FGG-53S | Native Sheep Fibrinogen | +Inquiry |
APOA1-8344H | Native Human APOA1 | +Inquiry |
GUSB-12H | Active Native Helix pomatia b-Glucuronidase | +Inquiry |
KS-01P | Native Pig protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD1d1-2446MCL | Recombinant Mouse CD1d1 cell lysate | +Inquiry |
KIAA1530-4962HCL | Recombinant Human KIAA1530 293 Cell Lysate | +Inquiry |
TCEAL7-658HCL | Recombinant Human TCEAL7 lysate | +Inquiry |
FOXN2-6151HCL | Recombinant Human FOXN2 293 Cell Lysate | +Inquiry |
SRD5A2-1480HCL | Recombinant Human SRD5A2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MIMI_L310 Products
Required fields are marked with *
My Review for All MIMI_L310 Products
Required fields are marked with *
0
Inquiry Basket