Recombinant Full Length Abc Transporter Atp-Binding Protein/Permease Wht-1(Wht-1) Protein, His-Tagged
Cat.No. : | RFL1966CF |
Product Overview : | Recombinant Full Length ABC transporter ATP-binding protein/permease wht-1(wht-1) Protein (Q11180) (1-598aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Caenorhabditis elegans |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-598) |
Form : | Lyophilized powder |
AA Sequence : | MPKRRVKEILHNVSGMAESGKLLAILGSSGAGKTTLMNVLTSRNLTNLDVQGSILIDGRR ANKWKIREMSAFVQQHDMFVGTMTAREHLQFMARLRMGDQYYSDHERQLRVEQVLTQMGL KKCADTVIGIPNQLKGLSCGEKKRLSFASEILTCPKILFCDEPTSGLDAFMAGHVVQALR SLADNGMTVIITIHQPSSHVYSLFNNVCLMACGRVIYLGPGDQAVPLFEKCGYPCPAYYN PADHLIRTLAVIDSDRATSMKTISKIRQGFLSTDLGQSVLAIGNANKLRAASFVTGSDTS EKTKTFFNQDYNASFWTQFLALFWRSWLTVIRDPNLLSVRLLQILITAFITGIVFFQTPV TPATIISINGIMFNHIRNMNFMLQFPNVPVITAELPIVLRENANGVYRTSAYFLAKNIAE LPQYIILPILYNTIVYWMSGLYPNFWNYCFASLVTILITNVAISISYAVATIFANTDVAM TILPIFVVPIMAFGGFFITFDAIPSYFKWLSSLSYFKYGYEALAINEWDSIKVIPECFNS SMTAFALDSCPKNGHQVLESIDFSASHKIFDISILFGMFIGIRIIAYVALLIRSYNNT |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | wht-1 |
Synonyms | wht-1; C05D10.3; ABC transporter ATP-binding protein/permease wht-1 |
UniProt ID | Q11180 |
◆ Recombinant Proteins | ||
AZIN1-1291HF | Recombinant Full Length Human AZIN1 Protein, GST-tagged | +Inquiry |
OR4D6-3019R | Recombinant Rhesus Macaque OR4D6 Protein, His (Fc)-Avi-tagged | +Inquiry |
Gm11992-3236M | Recombinant Mouse Gm11992 Protein, Myc/DDK-tagged | +Inquiry |
Grik2-1063M | Recombinant Mouse Grik2 Protein, MYC/DDK-tagged | +Inquiry |
SAR1A-0607H | Recombinant Human SAR1A Protein (M1-D198), His/Strep tagged | +Inquiry |
◆ Native Proteins | ||
CED026 | Active Bovine Superoxide Dismutase (SOD), High Purity >95% | +Inquiry |
S-52H | Native Human Protein S | +Inquiry |
Collagen Type I-10G | Native Goat Collagen Type I Protein | +Inquiry |
TcdA-188C | Active Native Clostridium difficile Toxin A Protein | +Inquiry |
Plg-5356M | Native Mouse Plg protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CLN5-7439HCL | Recombinant Human CLN5 293 Cell Lysate | +Inquiry |
SDC1-1295RCL | Recombinant Rat SDC1 cell lysate | +Inquiry |
SGSM3-1883HCL | Recombinant Human SGSM3 293 Cell Lysate | +Inquiry |
Brain-84M | Mouse Brain Tissue Lysate (7 Days Old) | +Inquiry |
RGMA-1697HCL | Recombinant Human RGMA cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All wht-1 Products
Required fields are marked with *
My Review for All wht-1 Products
Required fields are marked with *
0
Inquiry Basket