Recombinant Full Length 34 Kda Antigenic Protein Homolog (Mb0979) Protein, His-Tagged
Cat.No. : | RFL17735MF |
Product Overview : | Recombinant Full Length 34 kDa antigenic protein homolog (Mb0979) Protein (P65638) (1-303aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mycobacterium Bovis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-303) |
Form : | Lyophilized powder |
AA Sequence : | MTYSPGNPGYPQAQPAGSYGGVTPSFAHADEGASKLPMYLNIAVAVLGLAAYFASFGPMF TLSTELGGGDGAVSGDTGLPVGVALLAALLAGVALVPKAKSHVTVVAVLGVLGVFLMVSA TFNKPSAYSTGWALWVVLAFIVFQAVAAVLALLVETGAITAPAPRPKFDPYGQYGRYGQY GQYGVQPGGYYGQQGAQQAAGLQSPGPQQSPQPPGYGSQYGGYSSSPSQSGSGYTAQPPA QPPAQSGSQQSHQGPSTPPTGFPSFSPPPPVSAGTGSQAGSAPVNYSNPSGGEQSSSPGG APV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | BQ2027_MB0979 |
Synonyms | BQ2027_MB0979; 34 kDa antigenic protein homolog |
UniProt ID | P65638 |
◆ Native Proteins | ||
PDHB-1860B | Native Bovine Pyruvate Dehydrogenase (lipoamide) Beta | +Inquiry |
Lectin-1860W | Active Native Wheat Germ Agglutinin Protein, Biotinylated | +Inquiry |
Ighg2a-161M | Native Mouse Immunoglobulin G2a | +Inquiry |
ALB-112P | Native Pigeon Serum Albumin | +Inquiry |
Lectin-1789G | Active Native Griffonia Simplicifolia Lectin II Protein, Fluorescein labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
C14orf21-208HCL | Recombinant Human C14orf21 cell lysate | +Inquiry |
CCM2-7719HCL | Recombinant Human CCM2 293 Cell Lysate | +Inquiry |
DLGAP4-484HCL | Recombinant Human DLGAP4 cell lysate | +Inquiry |
ADCK5-11HCL | Recombinant Human ADCK5 lysate | +Inquiry |
CCDC67-160HCL | Recombinant Human CCDC67 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All BQ2027_MB0979 Products
Required fields are marked with *
My Review for All BQ2027_MB0979 Products
Required fields are marked with *
0
Inquiry Basket