Recombinant Escherichia coli YJBL Protein (1-84 aa), His-KSI-tagged
Cat.No. : | YJBL-2618E |
Product Overview : | Recombinant Escherichia coli (strain K12) YJBL Protein (1-84 aa) is produced by E. coli expression system. This protein is fused with a 10xHis-KSI tag at the N-terminal. Protein Description: Full Length. |
- Specification
- Gene Information
- Related Products
- Download
Species : | E.coli |
Source : | E.coli |
Tag : | His&KSI |
Protein Length : | 1-84 aa |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 25.1 kDa |
AA Sequence : | MLKIIPGATGYFNKTLNSNQFDNEDAIKDKLDNRGSIKGKLNNIYGKSIDYAALRHRDIIIAKIDLFIQRITHNLWHARKKMCF |
Purity : | > 85% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
Gene Name | yjbL uncharacterized protein YjbL [ Escherichia coli str. K-12 substr. MG1655 ] |
Official Symbol | YJBL |
Synonyms | yjbL; ECK4039; |
Gene ID | 948551 |
Protein Refseq | NP_418471 |
UniProt ID | P32693 |
◆ Recombinant Proteins | ||
YJBL-2618E | Recombinant Escherichia coli YJBL Protein (1-84 aa), His-KSI-tagged | +Inquiry |
YJBL-3712B | Recombinant Bacillus subtilis YJBL protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All YJBL Products
Required fields are marked with *
My Review for All YJBL Products
Required fields are marked with *
0
Inquiry Basket