Recombinant Escherichia coli TSR Protein (211-551 aa), His-tagged

• Cat.No.: TSR-1607E
• Product Overview: Recombinant Escherichia coli (strain K12) TSR Protein (211-551 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Partial.

Specification

• Species: E.coli
• Source: Yeast
• Tag: His
• Protein Length: 211-551 aa
• Description: Receptor for the attractant L-serine and related amino acids. Is also responsible for chotaxis away from a wide range of repellents, including leucine, indole, and weak acids.Chotactic-signal transducers respond to changes in the concentration of attractants and repellents in the environment, transduce a signal from the outside to the inside of the cell, and facilitate sensory adaptation through the variation of the level of methylation. Attractants increase the level of methylation while repellents decrease the level of methylation, the methyl groups are added by the methyltransferase CheR and roved by the methylesterase CheB.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 38.0 kDa
• AA Sequence: WFGIKASLVAPMNRLIDSIRHIAGGDLVKPIEVDGSNEMGQLAESLRHMQGELMRTVGDVRNGANAIYSGASEIATGNNDLSSRTEQQAASLEETAASMEQLTATVKQNAENARQASHLALSASETAQRGGKVVDNVVQTMRDISTSSQKIADIISVIDGIAFQTNILALNAAVEAARAGEQGRGFAVVAGEVRNLAQRSAQAAREIKSLIEDSVGKVDVGSTLVESAGETMAEIVSAVTRVTDIMGEIASASDEQSRGIDQVGLAVAEMDRVTQQNAALVEESAAAAAALEEQASRLTEAVAVFRIQQQQRETSAVVKTVTPAAPRKMAVADSEENWETF
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with reconstitution instruction is sent along with the products.

Gene Information

• Gene Name: tsr methyl-accepting chemotaxis protein Tsr [ Escherichia coli str. K-12 substr. MG1655 ]
• Official Symbol: TSR
• Synonyms: cheD; ECK4345
• Gene ID: 948884
• Protein Refseq: NP_418775
• UniProt ID: P02942