Recombinant Escherichia coli (strain K12) zapD protein(1-247aa), His&Myc-tagged
Cat.No. : | zapD-7522E |
Product Overview : | Recombinant Escherichia coli (strain K12) zapD protein(P36680)(1-247aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | E.coli |
Source : | E.coli |
Tag : | N-His&C-Myc |
ProteinLength : | 1-247aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 35.7 kDa |
AASequence : | MQTQVLFEHPLNEKMRTWLRIEFLIQQLTVNLPIVDHAGALHFFRNVSELLDVFERGEVRTELLKELDRQQRKLQTWIGVPGVDQSRIEALIQQLKAAGSVLISAPRIGQFLREDRLIALVRQRLSIPGGCCSFDLPTLHIWLHLPQAQRDSQVETWIASLNPLTQALTMVLDLIRQSAPFRKQTSLNGFYQDNGGDADLLRLNLSLDSQLYPQISGHKSRFAIRFMPLDTENGQVPERLDFELACC |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
◆ Recombinant Proteins | ||
CD274-189MAF488 | Active Recombinant Mouse Interleukin CD274 Protein, MIgG2a mFc-tagged Protein, mutant, Alexa Fluor 488 conjugated | +Inquiry |
HIST1H2AA-115H | Recombinant Human HIST1H2AA Protein, HIS-tagged | +Inquiry |
CA9-256HF | Recombinant Human CA9 Protein, His-tagged, FITC conjugated | +Inquiry |
TNFSF9-2605H | Active Recombinant Human TNFSF9 protein, His-tagged | +Inquiry |
PAI-1-896C | Recombinant Cat PAI-1 protein | +Inquiry |
◆ Native Proteins | ||
Actin-889P | Native Porcine Actin Protein | +Inquiry |
ORM1-8016R | Native Rabbit Serum Alpha-1-Acid GlycoProtein | +Inquiry |
CA-50-381H | Active Native Human Cancer Antigen 50 | +Inquiry |
REN -16H | Recombinant Human Prorenin, His-tagged | +Inquiry |
IgG-151M | Native Mouse IgG Fab fragment | +Inquiry |
◆ Cell & Tissue Lysates | ||
CCT4-7688HCL | Recombinant Human CCT4 293 Cell Lysate | +Inquiry |
DDX23-7014HCL | Recombinant Human DDX23 293 Cell Lysate | +Inquiry |
GFRA2-2408MCL | Recombinant Mouse GFRA2 cell lysate | +Inquiry |
PARP6-3427HCL | Recombinant Human PARP6 293 Cell Lysate | +Inquiry |
ATP1B1-919HCL | Recombinant Human ATP1B1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All zapD Products
Required fields are marked with *
My Review for All zapD Products
Required fields are marked with *
0
Inquiry Basket