Recombinant Escherichia coli RPSO Protein (30S) (2-89 aa), His-tagged

Cat.No. : RPSO-1232E
Product Overview : Recombinant Escherichia coli (strain K12) RPSO Protein (30S) (2-89 aa) is produced by E. coli expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Full Length of Mature Protein.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : E.coli
Source : E.coli
Tag : His
Protein Length : 2-89 aa
Description : One of the primary rRNA binding proteins, it binds directly to 16S rRNA where it helps nucleate assbly of the platform of the 30S subunit by binding and bridging several RNA helices of the 16S rRNA.In the E.coli 70S ribosome it has been modeled to contact the 23S rRNA of the 50S subunit forming part of bridge B4. In the two 3.5 A resolved ribosome structures there are minor differences between side-chain conformations.
Form : Tris-based buffer,50% glycerol
Molecular Mass : 14.1 kDa
AA Sequence : SLSTEATAKIVSEFGRDANDTGSTEVQVALLTAQINHLQGHFAEHKKDHHSRRGLLRMVSQRRKLLDYLKRKDVARYTQLIERLGLRR
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with reconstitution instruction is sent along with the products. Please refer to it for detailed information.
Gene Name rpsO 30S ribosomal subunit protein S15 [ Escherichia coli str. K-12 substr. MG1655 ]
Official Symbol RPSO
Synonyms ECK3154; secC;
Gene ID 947686
Protein Refseq NP_417634
UniProt ID P0ADZ4

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All RPSO Products

Required fields are marked with *

My Review for All RPSO Products

Required fields are marked with *

0

Inquiry Basket

cartIcon