Recombinant Escherichia coli RPSM Protein (30S) (2-118 aa), GST-tagged

Cat.No. : RPSM-1233E
Product Overview : Recombinant Escherichia coli (strain K12) RPSM Protein (30S) (2-118 aa) is produced by E. coli expression system. This protein is fused with a GST tag at the N-terminal. Protein Description: Full Length of Mature Protein.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : E.coli
Source : E.coli
Tag : GST
Protein Length : 2-118 aa
Description : Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA.
Form : Tris-based buffer,50% glycerol
Molecular Mass : 40.0 kDa
AA Sequence : ARIAGINIPDHKHAVIALTSIYGVGKTRSKAILAAAGIAEDVKISELSEGQIDTLRDEVAKFVVEGDLRREISMSIKRLMDLGCYRGLRHRRGLPVRGQRTKTNARTRKGPRKPIKK
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with reconstitution instruction is sent along with the products. Please refer to it for detailed information.
Gene Name rpsM 30S ribosomal subunit protein S13 [ Escherichia coli str. K-12 substr. MG1655 ]
Official Symbol RPSM
Synonyms ECK3285;
Gene ID 947791
Protein Refseq NP_417757
UniProt ID P0A7S9

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All RPSM Products

Required fields are marked with *

My Review for All RPSM Products

Required fields are marked with *

0

Inquiry Basket

cartIcon