Recombinant Escherichia coli RPSH Protein (30S) (2-130 aa), His-tagged

• Cat.No.: RPSH-1223E
• Product Overview: Recombinant Escherichia coli (strain K12) RPSH Protein (30S) (2-130 aa) is produced by E. coli expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Full Length of Mature Protein.

Specification

• Species: E.coli
• Source: E.coli
• Tag: His
• ProteinLength: 2-130 aa
• Description: One of the primary rRNA binding proteins, it binds directly to 16S rRNA central domain where it helps coordinate assbly of the platform of the 30S subunit.Protein S8 is a translational repressor protein, it controls the translation of the spc operon by binding to its mRNA.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 18.0 kDa
• AA Sequence: SMQDPIADMLTRIRNGQAANKAAVTMPSSKLKVAIANVLKEEGFIEDFKVEGDTKPELELTLKYFQGKAVVESIQRVSRPGLRIYKRKDELPKVMAGLGIAVVSTSKGVMTDRAARQAGLGGEIICYVA
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with reconstitution instruction is sent along with the products. Please refer to it for detailed information.

Gene Information

• Synonyms: rpsH
• UniProt ID: P0A7W7